KEGG   Edwardsiella piscicida C07-087: ETAC_06810Help
Entry
ETAC_06810        CDS       T02509                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00030  Pentose phosphate pathway
etc00480  Glutathione metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
etc_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
etc_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ETAC_06810
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ETAC_06810
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_06810
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     ETAC_06810
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     ETAC_06810
Exosome [BR:etc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ETAC_06810
  Exosomal proteins of colorectal cancer cells
   ETAC_06810
  Exosomal proteins of bladder cancer cells
   ETAC_06810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N HetR_C
Motif
Other DBs
NCBI-ProteinID: AGH73483
Position
1555390..1556862
Genome map
AA seq 490 aa AA seqDB search
MAVTSTAQACDLIIFGAKGDLARRKLLPSLYQLEKAGHIHPETRIIGVGRAEWDAAAYRK
VVHEALDTFLKEPLDDALWQRLSDRLDFCNLDVNDTEQFQRLAERVTPQQRVTINYFAMP
PSTFGAICQGLGHAGMNLQPSRIVMEKPLGTDLASSRAINDQVARYFDEDQVYRIDHYLG
KETVLNLLALRFANALFANNWDNSMIDHVQITVAEEVGIEGRWGYFDQAGQMRDMVQNHL
LQILTMIAMDPPADLSTDRIRDEKVKVLRSLRRINHSNVRETTVRGQYTAGFVQGKKVPG
YLEEEGANKCSNTETFIAIRVDIDNWRWAGVPFYLRTGKRLPSKCSEVVIYFKNPPLNLF
SDSYQALPQNKLTIRLQPDEGVQIDILNKVPGLEHKHRLQTTKLDLSFSDTFHQEHLADA
YERLLLEAMRGIQALFVRRDEVEEAWKWVDSIMMAWADDNDAPKPYQAGTWGPVSSVALI
TRDGRCWNEF
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcggtaacgtcaacggcacaggcttgcgacctgattatttttggcgccaagggcgat
ttggctcggcgcaaactgctgccttccctgtatcagctggaaaaggccggccacattcac
cccgagacgcgcattatcggcgtcggccgcgccgagtgggatgccgcggcctaccgtaag
gtggttcatgaggcgctggatacctttttgaaagagccgctggacgatgcgctgtggcag
cgtctgagcgaccgcctcgacttttgtaacttggacgtcaacgataccgagcaatttcag
cgtctggcggagagggtgacaccgcagcagcgggtgaccattaactattttgctatgccg
ccgagcacctttggcgcgatttgccaggggctggggcatgcggggatgaaccttcagccc
agccgtatcgtcatggagaagccgctgggaaccgatctggcctcatcgcgggcgatcaac
gatcaggtggcgcgctattttgatgaggaccaggtgtaccgcatcgaccactacctaggg
aaggagacggtgctgaacctgctggcgctgcgctttgccaacgcgctgtttgccaacaac
tgggacaacagcatgatcgaccacgtgcagatcaccgtggcggaagaggtcggcattgaa
gggcgctggggatactttgatcaggccgggcagatgcgcgatatggtgcagaaccatctg
ctgcagatcctgaccatgatcgccatggatccaccggcggatctctccaccgaccgtatt
cgtgatgaaaaggtcaaggtgctgcgctccctgcgtcgtatcaaccatagcaacgtgcgt
gagacgacggtgcgcggtcagtacaccgccggcttcgtgcaggggaaaaaggtaccggga
tacctggaagaagagggcgcgaacaagtgcagcaatacggaaacctttatcgccattcgc
gtcgatatcgacaactggcgctgggcaggggtgccgttttatctgcgcaccggtaagcgc
ctgccgagcaagtgctctgaggtggttatctatttcaaaaatccgccgctgaacctgttc
agcgactcctatcaggcgctgccgcagaataagctgaccattcgcctgcagccggacgaa
ggggtgcagatcgatatcctgaataaggtgccggggctggagcataaacaccgactgcag
accaccaagctggatctgagcttctccgataccttccaccaggagcatctggcggatgcc
tatgaacgcctgctgctggaggcgatgcgcggtattcaggcgctgtttgtccgccgcgat
gaggtggaagaggcctggaagtgggtcgactccatcatgatggcctgggccgacgacaac
gacgcgccgaagccttatcaggcgggcacctgggggccggtgtcatcggtggcgctgatc
acccgtgacggtcgttgctggaacgaattctga

DBGET integrated database retrieval system