KEGG   Edwardsiella piscicida C07-087: ETAC_06815Help
Entry
ETAC_06815        CDS       T02509                                 

Definition
(GenBank) 6-phosphogluconolactonase
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00030  Pentose phosphate pathway
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
etc_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
etc_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ETAC_06815
Enzymes [BR:etc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     ETAC_06815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucosamine_iso
Motif
Other DBs
NCBI-ProteinID: AGH73484
Position
1556917..1557612
Genome map
AA seq 231 aa AA seqDB search
MAHFIEFGSADALNTQLAQAIAERLRQGIAARGQASLVVSGGRTPLGLFAVLREQTLDWS
RVWVTLADERWVGADDEASNETLVRANLLQGPAAAAHFIGLKNDAATPFDGAKAAEAALA
AMARPFDALILGMGDDGHTASLFPGAENLFPALAMDSGRVCMGMTPLTAPLDRITLTLPA
LLDSRHIYLHLVGNAKRRVYEQAAGGAEVNEMPIRAVLQQSMTPVDVYWTA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggcacactttatcgaatttggcagcgcggacgcgctgaacacgcagctggcacaggct
atcgccgagcgtttgcgccaggggatcgccgcccgcgggcaggctagcctggtggtatcc
ggtggacgcactccgctgggcctgtttgcggtgctgcgtgagcagacgctcgattggtca
cgggtctgggtgaccctggcggacgaacgctgggtcggggccgacgatgaggccagcaac
gagacgctggtacgggcgaacctgttacaggggccggcggcggcggcgcactttattggc
ctgaagaatgacgcggcgaccccttttgacggcgcaaaagccgcagaggcggcgctggcg
gcaatggcgcgtccctttgacgcgctgatcctgggtatgggggacgacggccataccgca
tcacttttccccggggcagagaatctgttcccggctctcgcgatggactccggacgcgtg
tgtatggggatgaccccgctcacggcgccgctcgatcgcatcaccctcacactcccggcc
ctgctggacagccgtcatatttacctgcatttggtgggcaacgccaaacgcagggtgtat
gagcaggccgccggcggagcggaggtgaatgagatgccgatccgcgccgtgctccagcag
agcatgacgccggtcgacgtctactggacggcatga

DBGET integrated database retrieval system