KEGG   Edwardsiella piscicida C07-087: ETAC_06820Help
Entry
ETAC_06820        CDS       T02509                                 

Definition
(GenBank) phosphogluconate dehydratase
  KO
K01690  phosphogluconate dehydratase [EC:4.2.1.12]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00030  Pentose phosphate pathway
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc01200  Carbon metabolism
Module
etc_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ETAC_06820
Enzymes [BR:etc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.12  phosphogluconate dehydratase
     ETAC_06820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: AGH73485
Position
1557620..1559440
Genome map
AA seq 606 aa AA seqDB search
MNPIVERVTQRIIERSRATRAAYLAKIERARSTRVQRAQLACGNLAHGFAACTQQDKASL
KSMTKSDIAIITSYNDMLSAHQPYESYPEQIKQALHQVGAVGQVAGGVPAMCDGVTQGQD
GMELSLMSREVIAMSAAVGLSHNMFDGALYLGVCDKIVPGLFMAAMSFGHLPTLFVPAGP
MASGLPNKEKVRIRQLFAEGKVGRDALLESEAASYHAPGTCTFYGTANSNQMVMEVMGMH
LPGASFVQPDCALRHALTDAAARQVTRMTESSGSYLPVGRMVDEKVVVNGIVALLATGGS
TNLTMHLVAMARAAGILINWDDFSELSEAVPLLCRIYPNGPADINHFQAAGGVALLVREL
LKGGLLHDDVDTVAGHGLRRYTQEPFLENGQLVYREGAERSYDTAVIASVEAPFAHHGGT
KVLSGNLGRAVMKTSAVPEENQIIEAPAVVFNSQHDVLPAFEAGALDRDCVVVVRYQGPR
AIGMPELHKLMPPLGVLMDRGLKVALVTDGRLSGASGKVPSAIHVTPEACAGGLLAKVRN
GDMIRVDGRSGELTLLVDEAELATRDAFQPDLSALHDGCGRELFNALREQLSGAEEGASC
IPFYRS
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaatcgtagaacgtgttacccaacgcattattgaacgctctcgcgctacccgc
gcggcgtatctggccaagattgagcgagcgcgcagcacacgcgtgcagcgcgcccagctg
gcgtgtggcaacctggcgcacggctttgccgcctgtactcagcaggataaggcatcgctg
aagagcatgaccaaaagtgatatcgcgattatcacctcgtataacgatatgctgtccgcc
caccagccctatgagagctatccggagcagattaagcaggcgctgcatcaggtgggggct
gtcggtcaggtagccggcggcgtgccggcgatgtgtgacggggtgactcagggtcaggac
ggcatggagctgtcgctgatgagtcgcgaagtgatagccatgtccgccgcggtcgggctg
tcgcataacatgttcgacggcgcgctgtacctgggcgtctgtgacaagatcgtgccggga
ttgttcatggcggcgatgtcctttggccatctgccgaccctgttcgtaccggccgggccg
atggccagcggtctgccgaacaaagagaaggtgcgcatccgtcagctgtttgctgagggt
aaggtcgggcgcgatgccctgctggagtcagaggccgcctcctaccatgcgccgggcacc
tgtacattctatggcacggccaactccaaccagatggtgatggaggtgatggggatgcac
ctgccgggagcctccttcgttcagccggactgtgcgctgcgccatgcgctgaccgacgcg
gcggcgcgtcaggtgacgcgaatgacggagagcagcggcagctatctgccggtcgggcgg
atggtggatgaaaaggtcgtggtaaacggcattgtcgccctgctggcgaccggcggctcg
accaacctcaccatgcacctggtggcgatggcgcgcgccgcgggcatcctgatcaactgg
gatgacttctctgagctgtcagaggcggtgccgctgctgtgccgtatttaccccaacggt
ccggcggatatcaaccacttccaggcggccggcggcgtggcgctgctggtgcgcgaactg
ctgaagggcgggctgctgcatgacgacgttgacaccgtggcgggtcacggcctgcgccgt
tacacccaggagccgttcctggagaacgggcagctggtttaccgcgaaggcgccgagcgc
tcctacgatacggcggtgattgccagcgttgaggcgccgttcgcccaccacggggggact
aaagtgctgtccggtaacctggggcgcgcggtgatgaagacctcggcggtaccggaagag
aaccagattattgaggcgccggcggtggtgtttaacagtcagcatgacgtgctgccggcc
tttgaagcgggtgcgctggatcgcgactgcgtggtggtcgtgcgctatcaggggccgcgg
gccatcgggatgccggagctgcacaagctgatgccgccgctgggggtgctgatggatcgc
gggctgaaggtggcgctggtgacggatggccgtctgtccggcgcctcgggtaaagtgccg
tcggcgattcacgtgacgccggaggcctgcgccggcggtctgttggccaaggtgcgcaac
ggcgacatgatccgggtcgatggacgcagcggcgagctgaccctgctggtggatgaggcg
gagctggcgacgcgcgatgcattccagccggatctctccgcgctgcacgacggctgtggc
cgcgagctgttcaacgcgctgcgtgaacagctgtccggcgccgaagagggcgccagctgc
atcccgttttaccgttcctaa

DBGET integrated database retrieval system