KEGG   Edwardsiella piscicida C07-087: ETAC_06825Help
Entry
ETAC_06825        CDS       T02509                                 

Definition
(GenBank) keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
  KO
K01625  2-dehydro-3-deoxyphosphogluconate aldolase / (4S)-4-hydroxy-2-oxoglutarate aldolase [EC:4.1.2.14 4.1.3.42]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00030  Pentose phosphate pathway
etc00630  Glyoxylate and dicarboxylate metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc01200  Carbon metabolism
Module
etc_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
etc_M00061  D-Glucuronate degradation, D-glucuronate => pyruvate + D-glyceraldehyde 3P
etc_M00631  D-Galacturonate degradation (bacteria), D-galacturonate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ETAC_06825
   00630 Glyoxylate and dicarboxylate metabolism
    ETAC_06825
Enzymes [BR:etc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.14  2-dehydro-3-deoxy-phosphogluconate aldolase
     ETAC_06825
   4.1.3  Oxo-acid-lyases
    4.1.3.42  (4S)-4-hydroxy-2-oxoglutarate aldolase
     ETAC_06825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase HMGL-like IMPDH
Motif
Other DBs
NCBI-ProteinID: AGH73486
Position
1559575..1560216
Genome map
AA seq 213 aa AA seqDB search
MNNWKVSAESILTTGPVVPVIVINTLEQAVPLAKALVAGGVRVLEVTLRTDCALEAIRLI
AQEVPEAIVGAGTVTNAEQLRQVTEAGAQFAISPGLTEGLLQAAVAGSIPLIPGISTVSE
LMQGMDYGLKEFKFFPAEANGGVKALQAIAGPFSHIRFCPTGGISPSNYRSYLALKSVLC
IGGSWLIPADALENGDYARITALAKEAVAGAQA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaacaactggaaagtgagtgcggaatccattctgacaacaggcccggtcgtaccggtt
atcgttatcaacacgctggagcaggccgtgcctttggccaaggcgctggttgccggtggg
gttcgggtactggaagtgaccctgcgtaccgactgtgcgctggaggctatccgcctgatt
gcccaggaggtgccagaggctatcgtcggcgccggtaccgtgaccaatgcggagcagctg
cgccaggtgaccgaggccggcgcccagttcgccatcagcccggggctgaccgagggtctg
ctgcaggccgcggtggccggcagcatcccgctgatcccgggtatcagcaccgtttctgag
ctgatgcaggggatggactacggtctgaaagagtttaaattcttccccgcggaggccaac
ggcggcgtgaaagcgctgcaggctatcgccgggccgttctcccatatccgcttctgcccg
accggcggtatttcaccgagcaactaccgcagctacctggcgctgaagagcgtgctgtgc
atcggcggctcttggcttatcccggcggacgccctggaaaacggggactatgcgcggatc
accgcgttggcgaaagaggccgttgccggcgctcaggcgtaa

DBGET integrated database retrieval system