KEGG   Edwardsiella piscicida C07-087: ETAC_06945Help
Entry
ETAC_06945        CDS       T02509                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02471  vitamin B12/bleomycin/antimicrobial peptide transport system ATP-binding/permease protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_06945
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_06945
Transporters [BR:etc02000]
 ABC Transporters, Eukaryotic Type
  Other subfamilies
   Other ABC transporters
    ETAC_06945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane_2 SbmA_BacA ABC_tran AAA_29 NACHT AAA_16 SMC_N ABC_membrane AAA_23 AAA Rad17 AAA_21 IstB_IS21 AAA_28 T2SSE RsgA_GTPase AAA_22 AAA_30 AAA_5 ATPase_2 AAA_18 AAA_33 Zeta_toxin SbcCD_C AAA_25 NTPase_1 MMR_HSR1 MCM AAA_7 RNA_helicase DUF4714
Motif
Other DBs
NCBI-ProteinID: AGH73510
Position
complement(1581118..1582884)
Genome map
AA seq 588 aa AA seqDB search
MHFTQKATHWREVWQLIRPYWVSEEKVSAWTRLLAIVVLTLAAVYLNVLFNEWNRVFYDA
LQNRNYAVFKAQLIRFSYLAFIYIAIAIFRIYLTQGLQMLWRQWMTRRYMDKWLGHQAYY
HTEMQQSIDNPDQRIAQDLNALTSGTLSLTLGLLSSLVTLFSFVAILWSVSGSLSLMIAG
HALEIPGYMVWFALLYAGLGSMMIWLVGRPLVDLSFDQERFEANFRFGLIRIRHNADPIA
LYHGEPQERQQLDGQFQNIRRNWWSIMRLTRRLNFASNFYGQFAIIFPILVAAPRYFANA
IQLGTLMQISSAFGQVQGALSWFINAFDDLASWKACVNRLAGFNKAVEEINAHPGGIRHG
QTAGADEALTIKALTLQLHQGRTLFNDVSLQVQRGDRVLITGPSGCGKSTLLRAIAGVWP
YGHGEILRPDETTLRTLFLPQRSYLPIGSLREAICYPYSATTYSDDELKSILQACRLSHL
CDALGSRANWSQQLSPGEQQRIAFARALALRPDILYLDEATSALDEDTEQHVYRLLEAYL
PGVTLISVAHRSSVAPFHTLRWRFRRETEDDQGREFAPSQVEVSALNA
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgcatttcacccaaaaagccacccactggcgggaagtgtggcagctgatcaggccctac
tgggtttcagaagaaaaagtcagcgcctggacccgtctgctcgccatcgtcgtcctgacc
ctggccgcggtgtacctcaatgtcctgtttaacgagtggaaccgggtattctacgatgcc
ctgcaaaaccggaactatgcggtattcaaggcgcagctgatccgctttagctatctggcg
tttatctacatcgcgatcgccatcttccgcatttacctgacccaggggctgcagatgctg
tggcgccaatggatgacccggcgctatatggataaatggctgggacaccaggcctattat
cacacggaaatgcagcagtcgatcgataaccccgaccagcgtatcgctcaggatctcaac
gcgttgaccagcggcacgctctccctgacgctggggctgctctccagcctggtgaccctg
ttctccttcgtcgcgatcctgtggtcggtctccggctcgctttcactgatgatcgccggc
catgcgctggagatccccggctacatggtgtggtttgccctgctgtatgccgggctcggc
tccatgatgatctggctggtgggccgcccgctggtcgatctctccttcgatcaggagcgc
tttgaggcaaacttccgctttggtctgatccggatccgccataacgccgaccccatcgcg
ctgtatcacggtgaaccgcaggagcgccagcaactggacggccagtttcagaatatccgc
cgcaactggtggagcatcatgcgtctgacccgacgcctcaacttcgccagcaacttttac
ggccagttcgccatcatcttcccgattctggtggccgcgccgcgctattttgccaacgct
atccagctgggcaccctgatgcagatctcctcggccttcggccaggtgcagggggcgcta
tcctggtttatcaacgcgtttgacgatctggcctcctggaaagcctgcgtaaaccgtctg
gccggattcaataaggcggtggaagagattaacgcccaccccggcggcatccgccatgga
caaaccgcgggcgccgacgaggcgctcacgatcaaggcgctgaccctgcagcttcaccaa
ggacgtacgctgtttaacgatgtcagtctgcaagtgcagcgcggcgatcgcgtgctgatc
accggcccctccggctgcggtaagtcgactctgctgcgcgccatcgccggcgtctggccc
tacggccacggcgagatcctgcgtccggatgaaacgacgctgcgcaccctgttcctgccg
cagcgcagctacctgccgataggcagcctgcgtgaggccatctgctacccctacagcgcg
accacctatagcgatgacgaactgaagtctatcctgcaagcctgccgcctaagccacctg
tgcgatgcgctgggcagccgcgccaactggtcacagcagctctcccccggggagcagcag
cgcatcgcctttgcgcgtgcgctggcgctgcgcccggatattctgtatctggatgaggcc
accagcgcgctggatgaagatactgagcagcacgtttaccgcctgctggaggcatacctg
ccgggcgtaacgctgatcagcgtcgctcaccgcagcagcgtcgcgccgttccataccctg
cgctggcgctttcgccgcgagacggaggatgaccaagggcgtgaatttgccccgtcgcag
gtcgaggtctccgcgctgaacgcctga

DBGET integrated database retrieval system