KEGG   Edwardsiella piscicida C07-087: ETAC_06975Help
Entry
ETAC_06975        CDS       T02509                                 

Definition
(GenBank) NAD-dependent glyceraldehyde-3-phosphate dehydrogenase
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
etc_M00002  Glycolysis, core module involving three-carbon compounds
etc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_06975
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:etc04131]
    ETAC_06975
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_06975
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     ETAC_06975
Membrane trafficking [BR:etc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ETAC_06975
Exosome [BR:etc04147]
 Exosomal proteins
  Proteins found in most exosomes
   ETAC_06975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AGH73516
Position
complement(1591169..1592164)
Genome map
AA seq 331 aa AA seqDB search
MTIKVGINGFGRIGRIVFRAAQERSDIEIVGINDLLDANYMAYMLKYDSTHGRFNGTVEV
KDGHLIVNGKKIRVTAERDPANLKWNEIGVDVVAEATGLFLTDETARKHIAAGAKKVVMT
GPSKDATPMFVMGVNHKNYAGQEIVSNASCTTNCLAPLAKVLNDNFGIVEALMTTVHATT
ATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSV
VDLTARLAKPATYQQICDVMKAASEGEMKGVLGYTDEAVVSTDFNGEVCTSVFDADAGIS
LNDNFVKLVSWYDNETGYSNKVLDLIAHISK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgactatcaaagtaggtatcaacggttttggccgtatcggccgtattgttttccgtgct
gctcaggaacgttctgacatcgaaatcgttggcatcaacgatctgctggatgccaactac
atggcatacatgctgaagtacgactctactcacggtcgtttcaacggcactgttgaagtg
aaagatggccacctgatcgttaacggtaaaaaaatccgtgttaccgctgaaagagatccg
gctaacctgaagtggaacgaaatcggcgttgacgttgttgccgaagcgaccggtctgttc
ctgaccgacgaaaccgcgcgtaagcacatcgccgccggtgccaagaaagtcgtcatgact
ggcccgtctaaagatgctaccccgatgttcgttatgggcgtaaaccacaagaactacgct
ggccaggagatcgtttccaacgcatcctgcaccaccaactgcctggctccgctggctaaa
gtcctgaacgacaacttcggcatcgttgaagcgctgatgaccaccgttcacgctaccacc
gcgacccagaaaactgtcgacggcccgtccatgaaagattggcgcggcggccgcggcgct
agccagaacatcatcccgtcctctaccggtgcagccaaggccgttggcaaggtcatcccg
gagctgaacggcaaactgaccggtatggctttccgcgttccgaccccgaacgtctccgtt
gttgacctgactgctcgcctggccaagccggcgacctatcagcagatctgtgacgtgatg
aaggccgcttctgaaggcgaaatgaaaggcgttctgggctacaccgacgaagccgtcgtt
tctaccgacttcaacggcgaagtatgcacctccgtgtttgatgccgacgccggtatctct
ctgaacgacaacttcgtgaaactggtttcttggtatgacaacgaaactggctactccaac
aaagttctggatctgatcgcacacatctctaagtaa

DBGET integrated database retrieval system