KEGG   Edwardsiella piscicida C07-087: ETAC_07095Help
Entry
ETAC_07095        CDS       T02509                                 

Gene name
oppB
Definition
(GenBank) oligopeptide transporter permease
  KO
K15581  oligopeptide transport system permease protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc01501  beta-Lactam resistance
etc02010  ABC transporters
etc02024  Quorum sensing
Module
etc_M00439  Oligopeptide transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_07095 (oppB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETAC_07095 (oppB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ETAC_07095 (oppB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_07095 (oppB)
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Oligopeptide transporter [MD:M00439]
    ETAC_07095 (oppB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AGH73540
Position
1617293..1618213
Genome map
AA seq 306 aa AA seqDB search
MLKFIFRRFLEAIPTLFILVTISFFMMRLAPGSPFTGERTLPPEVMANIEAKYHLNDPIW
KQYGHYLLQLSQGDFGPSFKYKDYSVNDLVAASFPVSAKLGFAAFVMAVVLGVSAGVIAA
LKQNSRWDYVVMTFAMTGVVIPSFVVAPLLVLIFAISLHWLPGGGWNGGALKFILLPMVA
LSLSYIAGIARITRGSMIEVLHSNFIRTARAKGLPLHRIVLRHALRPALLPVLSYMGPAF
VGIITGSMVIETIYGLPGIGQLFVNGALNRDYSLVLSLTILVGTLTIVFNAIVDVLYAVI
DPKIRY
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaatttatcttccgtcgcttcttggaagcgattccgacgctgtttattctggtc
accatctcgttttttatgatgcgtctggcgccgggcagcccgtttaccggtgaacgcacg
ctgccgccagaggtgatggccaatatcgaagccaaataccatcttaacgatcccatctgg
aagcagtatggccactacctgctgcagctctctcagggggactttggcccctcgttcaaa
tacaaggattattcggtcaacgatctggtggccgcctctttccccgtttcggccaagctg
ggctttgccgcctttgtcatggcggttgtgctgggggtctctgccggggtcatcgcggcc
ctaaagcagaactcgcgctgggactatgtggtgatgacctttgccatgaccggggtggtg
atcccaagctttgtggtcgcgccgctgctggtgctgatcttcgccatctcgctgcactgg
ctgccgggcggcggctggaacggtggggcgctgaagttcatactgctgccgatggtggcg
ctgtcgctctcctatattgccggtatcgcgcgcattacccgcggatcgatgatcgaggtg
ctgcactctaactttatccgcaccgcccgggccaaggggctgccgctgcaccgcattgtg
ctgcgccatgcgctgcgcccggcgctgctgccggtgctctcctacatggggcccgctttt
gtcggcattattaccggctcgatggtcattgagactatctacggcctgccggggatcggc
cagctgttcgtcaacggcgcgctgaacagggactactcgctggtgctgagcctgacgatc
ctggtcggcaccctgacgattgtctttaacgctatcgttgacgtgctgtacgccgtaatc
gatcccaaaatccgttactga

DBGET integrated database retrieval system