KEGG   Edwardsiella piscicida C07-087: ETAC_07110Help
Entry
ETAC_07110        CDS       T02509                                 

Definition
(GenBank) oligopeptide ABC transporter ATP-binding protein OppF
  KO
K10823  oligopeptide transport system ATP-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc01501  beta-Lactam resistance
etc02010  ABC transporters
etc02024  Quorum sensing
Module
etc_M00439  Oligopeptide transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_07110
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETAC_07110
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ETAC_07110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_07110
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Oligopeptide transporter [MD:M00439]
    ETAC_07110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_22 SMC_N AAA RsgA_GTPase MMR_HSR1 RNA_helicase NACHT PRK AAA_16 AAA_29 TniB AAA_25 MobB AAA_13
Motif
Other DBs
NCBI-ProteinID: AGH73543
Position
1620113..1621117
Genome map
AA seq 334 aa AA seqDB search
MSGSMSDKNVLLEVAELRVHFDIRDSKAWFWQPPKRLKAVDGVTLRLYQGETLGVVGESG
CGKSTFARALIGLVKATSGSVSWLGRDLLGMNEKQWREVRSDIQMIFQDPLASLNPRMTI
GEIIAEPLRTYYPQMARGEVRDRVKTMMMKVGLLPNLINRYPHEFSGGQCQRIGIARALI
LEPKLIICDEPVSALDVSIQAQVVNLLQSLQREMGLSLIFIAHDLAVVKHISDRVLVMYL
GHAVELGTYDEVYHNPQHPYTKALMSAVPVPDPDRERNKQIQLLEGELPSPIDPPSGCVF
RTRCPQAGPECAQTRPLLEGSFRHAVSCLKVDPL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggtcaatgagtgacaaaaacgtattgctggaagtggccgaactgcgggtccat
tttgatattcgagacagcaaggcctggttttggcagccgcccaagcgcctgaaggcggtg
gacggtgtgaccctgcgcctgtaccagggggaaaccctgggggttgtcggcgagtcaggc
tgcggcaagtcgacctttgcccgcgcgctgatcggtctggtgaaggcgacctccggtagc
gtcagctggctggggcgcgatctgctgggcatgaacgaaaagcagtggcgagaggtgcgc
agcgatatccagatgatctttcaggatccgctggcgtcgctaaacccgcggatgaccatc
ggggagattattgccgagcccctgcggacctattatccgcagatggcgcgcggcgaggtg
cgcgacagggtgaagacgatgatgatgaaggtgggcctgctgcccaacctcatcaaccgc
tatccgcacgaattctccggcggtcagtgtcagcgtattgggattgcccgggcgctgatc
ctggagcccaagctgattatctgcgacgagccggtgtcggcgctcgatgtatcgattcag
gcgcaggtggtcaacctgctgcagtcgctgcagcgagagatggggctgtcgctgatcttc
atcgcgcacgatctggcggtggtgaagcatatctccgaccgcgtgctggtgatgtatttg
ggacatgcggtggagctgggtacctatgatgaggtgtatcacaacccacagcacccctac
accaaggcgctgatgtcggcggtgccggtgccggatcccgatagggagcgcaataagcag
attcagctgctggagggggagctgccgtcgccgatcgatccgccgtcgggctgtgtgttc
cgcacccgctgtcctcaggccggaccggagtgcgcacagacccggccgctgctggagggc
agcttccgccacgcggtctcctgcctgaaggtcgatccgctgtag

DBGET integrated database retrieval system