KEGG   Edwardsiella piscicida C07-087: ETAC_07120Help
Entry
ETAC_07120        CDS       T02509                                 

Gene name
cls
Definition
(GenBank) cardiolipin synthetase
  KO
K06131  cardiolipin synthase A/B [EC:2.7.8.-]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00564  Glycerophospholipid metabolism
etc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ETAC_07120 (cls)
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     ETAC_07120 (cls)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLDc_2 PLDc PLDc_N
Motif
Other DBs
NCBI-ProteinID: AGH73545
Position
complement(1621564..1623024)
Genome map
AA seq 486 aa AA seqDB search
MSTFYTVISWLAIFGYWLLIASVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSFGE
LHLGKRRAERARAMWPSTARWLADLRSCRSIFATHNSEVAAPLFQLCERRQGIAGVKGNQ
LQLLTSTDDTLNALIRDIALAHNSIEMMFYIWQPGGLADQVAEAMMAAARRGVRCRLMLD
SAGSVAFFRSPYPAMMREAGIEVVEALQVNLLRVFLRRMDLRQHRKVVLIDNFIAYTGSM
NLVDPRYFKQDAGVGQWIDVMARMEGPVATTMGIYYAFDWEMETGKRILPPEPVCNILPF
EKESGHTIQVIASGPGFPEELIHQSLLTAVYSARQQLVMTTPYFVPSDDLLHAICTAAQR
GVDVSIIVPKKNDSMMVGWASRAFFTEMLAAGVKIYQFEGGLLHTKSVLVDGQLSLVGTV
NLDMRSLWLNFEITLVIDDDGFGSDLACVQEDYIARSSLLDPLEWLKRPLWQRVVERLFY
FFSPLL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagcactttttatacagtaatcagctggctggcgatctttggctactggctgctgatc
gccagcgtcacgttacggatattaatgaaacgccgggcggttccctccgccatggcgtgg
ctgctgatcatttacattctgccgttggtcggcattatcgcctatctctcctttggtgag
ctgcatctgggaaaacgccgcgccgaacgcgcgcgcgcgatgtggccatccaccgcccgc
tggctggccgatctgcgcagctgtcgcagcatttttgccacccataacagcgaggttgcc
gcaccgctgttccagctgtgcgaacggcgccagggcattgccggcgtcaagggtaaccag
ctacagctgctcacctctaccgatgacacgctcaatgccctgatccgcgatattgcgctg
gcgcataacagcattgagatgatgttttatatttggcagcccggcggattggccgatcaa
gttgccgaagcgatgatggcggcggcaagacgcggcgtacgctgccgcctgatgctcgat
tcggccggtagcgtggcgtttttccgcagcccttatccggccatgatgcgcgaagcgggt
attgaggtcgtcgaggcgctgcaggtcaacctgctgcgcgttttcctgcgccgcatggat
ctgcgtcagcaccgcaaggtggtgctgatcgacaactttatcgcctataccggcagcatg
aacctggttgacccgcgctactttaagcaggacgccggcgtcggacagtggatcgatgtc
atggcgcgtatggaggggccggtcgcaaccaccatgggcatctactatgccttcgactgg
gaaatggagaccggtaaacgcattctgccgccggagccggtatgcaatatcctccccttc
gaaaaagagtcgggtcacaccattcaggtgatcgcctccggccctggcttcccggaggag
ctgatccaccaatcgctcttgaccgccgtctactccgcgcgccagcagctggtgatgacc
accccctattttgtgcccagcgatgacctgctgcacgccatctgtaccgccgcccagcgc
ggcgtcgatgtctcgatcatcgtgccgaaaaagaatgactcgatgatggtcggctgggcc
agccgcgccttttttaccgaaatgctggccgccggcgttaaaatctatcagtttgagggc
ggtctgctgcataccaagagcgtgctggtcgacggtcagctcagtctggtcggcaccgtc
aacctggatatgcgcagcctgtggcttaattttgaaattacgctggtcatcgacgatgac
ggcttcggcagcgatctcgcctgcgtacaggaggactatatcgcgcgctcctccctgctg
gatccgctggagtggttaaaacgcccgctgtggcagcgcgtcgtcgaacgcctcttttac
tttttcagccctttgctgtaa

DBGET integrated database retrieval system