KEGG   Edwardsiella piscicida C07-087: ETAC_07175Help
Entry
ETAC_07175        CDS       T02509                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00260  Glycine, serine and threonine metabolism
etc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_07175
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ETAC_07175
Enzymes [BR:etc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ETAC_07175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: AGH73556
Position
complement(1631930..1632736)
Genome map
AA seq 268 aa AA seqDB search
MTRYQTLFTHLQRRREGALVPFVTLGDPTPALSLQIIDALVESGADALELGIPFSDPLAD
GPVIQNATLRALKAGMTPERCFTLLTTLREKYPQLPIGLLMYANLVVNPGIDTFYRRCAQ
AGVDSVLIADVPLEESAPFHAAAQRHGIAPIALCPPNADDALLQQLAARSQGYVYLLSRA
GVTGSDRTRLPPLRHLTTRLAALGAAPALQGFGIRTPDQVRSALDGGAAGVISGSAVVDL
IAQHLDNPPQMLQQLRAFIQTMKAATRA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgacacgctaccagacattatttacccatctacagcgccgccgggaaggcgcgttggtc
cccttcgtcacgctgggcgatcccacgccggcgctgtcgctgcaaattatcgacgcactg
gttgagtccggcgccgatgcgctggagctggggatccccttctctgacccgctggccgac
ggcccggtgatccagaatgcgaccctgcgcgccctgaaggcaggcatgacccccgagcgc
tgctttacgctgctgaccaccctgcgggaaaaatatccccagctgcccattgggctgctg
atgtacgctaacctggtggtcaatccggggatcgacaccttttaccggcgctgtgcccag
gccggcgtagactcggtattgattgccgatgtcccgctggaggagtccgcccccttccac
gcggcggcgcagcggcacgggatcgcgccgatcgccctgtgtccgcccaacgccgatgac
gcgctgctgcagcagctggccgcgcgcagtcaggggtatgtttacctgctgtcacgcgcc
ggggtcaccggcagcgatcgcacccgcctgcctccgctgcgccatctcacgacccggctg
gcggcgctgggtgccgcgccggcgctgcaggggttcgggattcggacccccgatcaggtg
cgcagtgcgctggatggcggggccgcgggcgtcatctccggctcggcggtggttgacctg
atcgcccagcatctggataacccgccccagatgctgcagcagctgcgcgcgtttatccaa
acgatgaaggctgccacgcgcgcctga

DBGET integrated database retrieval system