KEGG   Edwardsiella piscicida C07-087: ETAC_07185Help
Entry
ETAC_07185        CDS       T02509                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ETAC_07185
Enzymes [BR:etc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ETAC_07185
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     ETAC_07185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: AGH73558
Position
complement(1633965..1635341)
Genome map
AA seq 458 aa AA seqDB search
MTQPSPSPASLLSRIIADKRRWIAARERQQPLSDFQSTLRRSERDFHRALNATPRTLILE
CKKASPSRGLIRADFDPQAIARVYRDHAAAISVLTDGDYFQGDFRYLRAVSDVVTQPVLC
KDFILSPYQIYLARHYRADAILLMLSVLDDAQYRHLAAVATALNMGILTEVSTPAEMARA
VALGARAIGINNRNLHDLSVDPERTRHLAALAPPGATLIAESGIHSHAQIRDLGRLVQGF
LIGSALMSQPDLRSAVCRLRFGDNKVCGLTRPEDAVSALCSGAVYGGLIFVADSPRYVDI
ATARGIISAAPLRYVGVFRDAKPASVALAAERLDLHAVQLHGGEDQAYIDSLRPLLPAAC
RIWKALPVSDTLPTARLHHVDRYLLDGVRPGSGHPFDWRLLDGHPLGDIMLAGGIGADNC
RAAADLGALGLDLNSAVESAPGRKDPRKLRAAFQALLA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaccctcgccatcgcccgccagcctgctcagccgcatcatcgccgataaacgg
cgctggatcgccgcccgggaacggcagcagccgctgtcagactttcaatctaccctgcgg
cgcagcgaacgcgactttcaccgggcgctcaacgcgacgccgcgcaccctgatcctggag
tgtaaaaaagcatcgccttcgcgcgggctaatccgagctgactttgacccgcaggctatc
gcacgggtataccgcgatcatgccgccgccatctcggtcctaaccgacggcgactatttt
cagggtgacttccgctatctgcgcgcggtaagtgacgttgtcacgcagccggtgctgtgt
aaagacttcatcctctcgccttaccagatctatctggcgcgccactaccgcgccgatgcc
atcctgctgatgctctccgtattggacgatgcacagtaccgccatctggccgccgtggcc
acggcgctgaacatggggatcctcaccgaggtcagcacccccgccgaaatggcgcgcgcc
gtcgcgctgggcgccagggcgatcggtattaataaccgtaatctgcacgatctcagcgtc
gatcccgagcgtacccggcatctcgcggcgttggcgccgccgggcgcgacgcttatcgcc
gagtccggtatccacagccacgcccaaatccgcgacctgggtcgcctggtgcagggcttt
ttgatcggcagcgcgctgatgtctcagcccgatctgcgcagcgccgtctgtcgtctgcgc
tttggcgacaataaggtctgcggcctgacacgccctgaagacgcggtcagcgcgctgtgc
tccggcgccgtctacggcggcctgatcttcgttgccgactcgccgcgctacgtcgatatc
gccaccgcccgcggcattatttcggccgccccgctgcggtacgtcggggtctttcgcgac
gccaagcccgccagcgttgcgctggccgcagagcgcctggatctgcacgccgttcaactg
cacggcggcgaagatcaggcctatatcgatagcctgcgtccgctgttaccggcggcctgt
cggatttggaaggcgctgccggtcagcgataccctgcctaccgcgcgcctgcaccacgtc
gatcgctacctgcttgacggcgtacgccccggcagcggacacccctttgactggcgcctg
ctggatggacatcccctgggcgacatcatgctggccggggggatcggcgccgataactgc
cgcgcagcggccgacctcggcgcgctgggcctcgatcttaactccgccgtggagtccgct
cccgggcgtaaagatcccaggaaactccgtgcggccttccaggcgctgctcgcctga

DBGET integrated database retrieval system