KEGG   Edwardsiella piscicida C07-087: ETAC_07190Help
Entry
ETAC_07190        CDS       T02509                                 

Definition
(GenBank) anthranilate phosphoribosyltransferase
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ETAC_07190
Enzymes [BR:etc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     ETAC_07190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: AGH73559
Position
complement(1635367..1636383)
Genome map
AA seq 338 aa AA seqDB search
MSLTSEHLTILDKLYRAQVISRVESQRLFSAIVHGQLASSQLAAALISMKIRGEHPDEIA
GAASALLEAALPFPRPSYEFADIVGTGGDGSDSINISTASAFVAAACGVRIAKHGNRSVS
SRTGSSDLLQALGIRLDMSAEASRRALDELGLCFLFAPQYHSGFRHAMPVRQQLKTRTIF
NLLGPLINPARPTRALIGVYSPDRVLPLAQSLRGLGYQHAAVVHGGGLDEVALHAPTQVA
ELHQGEIRHYQLTARDFGLPDYPLSALRGGAPEENRILLTRLLQGGGAPAHQGAVAANVA
LLLRLFGQRDLAANARQALDVLRSGRAYHYVTALAARG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgacctctgagcatctgaccatattggataagctgtaccgggcgcaggtgatc
agtcgcgtggagagtcagcggctctttagcgccatcgtgcacggtcagctggcgtcgagc
cagctggccgccgcgctgatcagcatgaagatccgcggcgaacatcccgacgagatcgcc
ggcgccgccagcgcgctactggaagcggcgctgccgtttcctcgtccatcgtacgagttt
gccgacatcgtcggcaccggcggcgatggcagcgacagcatcaatatttcgaccgccagc
gcctttgtcgccgcggcctgcggcgtacgcatcgccaagcacggcaatcgcagcgtatcc
agccgtaccggatcgtcggatctgctgcaggcgctggggatccgcctggacatgagcgcc
gaggcatcgcgccgagcgctggatgagctggggctttgcttcctgttcgccccccagtac
cacagcggctttcgccatgccatgccggtgcgccagcagctcaagacccgcaccatcttt
aatctgctcggcccgctgatcaacccggcccggcccacccgagcgctgatcggcgtttac
agtcccgatcgggtgctaccgctggcgcagagcctgcgcggtttgggctatcaacatgcg
gcggtcgtgcacggcggcggactggatgaagtcgccctgcacgccccgacgcaggtggcg
gaactgcaccagggcgagatccgccactatcagctgacggcgcgtgacttcggcctgccg
gactatcccctcagcgcgctgcgcggcggtgcgccggaggagaaccgcatcctgttgact
cgcctgctccagggggggggcgcgcccgcgcatcagggcgccgtcgccgccaacgtggcc
ctgctactgcgcctgttcggccagcgcgatctggccgctaacgcccgccaggcgctggat
gtcctgcgcagcggacgggcctatcactatgtcaccgccctggccgcccgcggctaa

DBGET integrated database retrieval system