KEGG   Edwardsiella piscicida C07-087: ETAC_07195Help
Entry
ETAC_07195        CDS       T02509                                 

Definition
(GenBank) Anthranilate synthase, amidotransferase component TrpAb
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
etc02024  Quorum sensing
Module
etc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ETAC_07195
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    ETAC_07195
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETAC_07195
Enzymes [BR:etc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     ETAC_07195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26 Peptidase_S29
Motif
Other DBs
NCBI-ProteinID: AGH73560
Position
complement(1636374..1637009)
Genome map
AA seq 211 aa AA seqDB search
MADVLLLDNIDSFTYNLVDQLRSGGHRVVIYRNSVAPDTLLRHLDRLHQPLLMLSPGPGA
PADAGCMPALLQTLCGRLPIIGICLGHQAIVEHYGGQVDRAAEILHGRVCAIEHDGEAMF
RGLPSPLPVARYHSLAARRIPAELCVNAHVQGMVMAVRHDRQRVCGFQFHPESLLTPQGA
RLLEQSIDWARAAPPQPRLSPLSAAEVPPCH
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgtcttactgctcgacaatattgactcgtttacctacaacctggtcgatcag
ctgcgcagcggcggtcatcgggtggttatctaccgtaacagcgtcgcgccggatacgctg
ctgcggcatctggataggctgcaccagccgctgctgatgctctcccccggccccggcgcg
ccggctgacgcaggctgcatgcccgcgctgctgcaaacgctgtgcggacgcctgcccatc
atcggcatctgtctgggacaccaggctatcgtcgaacactatggtggccaggtcgatcgg
gcggcggaaatcctgcacgggcgggtctgcgccatcgaacacgatggcgaggccatgttt
cgtggcttgccgtccccgctgccggtagcgcgctatcattcgctggccgcccggcgcatt
ccggccgaactctgcgtcaacgcccacgtccagggcatggttatggcggtgcgccacgat
cgccagcgcgtctgcggtttccagtttcacccggagtcgctcctcacgccacagggcgcc
cgactgctggaacagagcatcgactgggcccgcgccgcgccaccccagccccgattatcc
cccctcagcgcagcagaggtcccgccatgtcactga

KEGG   Edwardsiella piscicida C07-087: ETAC_07200Help
Entry
ETAC_07200        CDS       T02509                                 

Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
etc02024  Quorum sensing
Module
etc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ETAC_07200
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    ETAC_07200
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETAC_07200
Enzymes [BR:etc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     ETAC_07200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AGH73561
Position
complement(1637009..1638583)
Genome map
AA seq 524 aa AA seqDB search
MHQAKTAVTVLTRSAAYSADPTLLFEQLCAQRPATLLLESADIASKHHLKSLLIIDSALR
ITAREREVTLESLSANGAALLTTLRHALPPDVACTCQAHGCTLTFPAQDNEQDEDSRLHT
PSVFDALRTLLSCQPTPDAEPEAMLLGGLFAYDLVAGFEPLPHLSAGPRCPDLCFYLAET
LLILDHRQGSARLQASLFSAAADEHQRLQRRLDALLTEMQRPFKATPVAPCPPLTVEVDR
DDEAFGAIVRDMQRAILAGDIFQAVPSRRFTLPCPAPLAAYRQLKQSNPSPYMFFMQDQA
FTLFGASPESALKYDADSRQVEIYPIAGTRPRGRRADGSIDRDLDGRLELDMRSDPKELA
EHLMLVDLARNDLARICEPGSRYVAELTNVDRYSVVMHLVSRIVGTLRADLDALHAYRAC
MNMGTLSGAPKVRAMQLIAASERRRRGSYGGAVGYLTARGDLDTCIVIRAAYVEDGVASV
QAGAGVVLDSQPQAEADETRSKARAVLNAIAAAHANPPQPQGAI
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaggccaaaacagccgtgaccgtattaacccgcagcgccgcttactccgcggat
ccgacgctgctttttgaacaactgtgtgcccagcgcccggcgacgctgctgctggagtct
gccgatatcgccagtaagcaccacctgaaaagtctcctgatcatcgatagcgccctgcgt
attaccgcgcgtgagcgagaggtcaccctggagtccttaagcgccaacggcgccgccctg
ctgaccaccctgcgtcatgccctgcccccagacgtagcctgtacgtgtcaggcccacggc
tgtacgctcacctttcccgcgcaggataatgagcaggatgaagacagccggctgcacacc
ccgtcggtattcgacgcgctgcgtaccctgctctcctgccagccaacgccggacgccgag
ccggaggccatgttactcggcggcctgttcgcctatgatctggtcgccggctttgagccc
ttgccacacctcagcgcagggccgcgctgccccgacctctgcttttatttggccgaaact
ctgctgatcctcgaccatcgtcagggtagcgcccgcctgcaggccagcctcttcagcgcc
gcggcggatgagcaccagcgcctgcagcgacgcctggatgctctgctgacggagatgcag
cgccccttcaaggcgacgcccgttgcgccctgtccgccgttaacggtcgaggtcgatcgg
gatgatgaggcgttcggcgcgatcgtccgcgacatgcagcgcgctatcctcgccggcgac
atttttcaggcagtcccctcacgccgcttcacgctgccgtgtcccgccccgctggccgcc
taccgccagctgaagcagagtaaccccagcccttacatgttcttcatgcaggatcaggcc
ttcacgctgttcggcgcctcgccggagagtgccctgaaatacgacgccgacagccgacag
gtcgaaatctaccccatcgcgggcacccgcccgcgcgggcggcgcgccgacggcagcatc
gatcgcgatctcgatggccgactggagctggacatgcgcagcgatcccaaagagctggcc
gaacacctgatgctggtcgatctggcgcgcaacgatctggcgcggatctgtgagccgggc
tcacgctacgtcgccgagctgaccaacgtggatcgctactccgtggtgatgcatctggtc
tcccggatcgttggcaccctgcgcgccgatctcgacgcgctgcatgcctaccgggcctgc
atgaatatgggcaccctgagcggcgcccccaaggtgcgcgccatgcagctgatcgccgcc
agcgaacggcggcggcgcggcagctacggcggcgccgtcggctacctcacggcccgcggc
gatctggatacctgtatcgttatccgcgccgcctacgtagaggatggcgtcgccagcgta
caggccggcgccggcgtggtactggactcccagcctcaggcggaggccgatgaaacccgc
agcaaggcccgggcggtgctgaacgccatcgcggcggcgcacgcgaatcccccccagccg
caaggagcgatctga

DBGET integrated database retrieval system