KEGG   Edwardsiella piscicida C07-087: ETAC_07225Help
Entry
ETAC_07225        CDS       T02509                                 

Definition
(GenBank) amino acid ABC transporter substrate-binding protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00234  L-Cystine transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_07225
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_07225
   02035 Bacterial motility proteins [BR:etc02035]
    ETAC_07225
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter [MD:M00234]
    ETAC_07225
Bacterial motility proteins [BR:etc02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    ETAC_07225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd
Motif
Other DBs
NCBI-ProteinID: AGH73566
Position
complement(1641732..1642502)
Genome map
AA seq 256 aa AA seqDB search
MKKTARALLALTLLSGGALAQSSDELAAIQSAGSIKFGTEGTYPPYTYHDASGKLVGFDV
DIARAVAAKMGLKPVFVEGRWDGLIAGLSAKRYDAVINQVGITPERQAKFDFSDPYVGAK
AVLIVRSDNAQLKSFDDLRGQKAAQSLTSNYAKLAEHYGADLVPTDGFNQSLELVISGRA
AATLNDNLSYLDFRQHKPNAPLKVVAVADQRADSAILVRKGQPQLVAALNRALSEIRADG
TYQTLSQRYFGSDVSQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacagcccgggctctgctggccctcaccctgctgagcggcggtgcgctggcc
cagagtagcgacgagttagcggcgatacagtccgcaggcagtatcaagtttggcaccgag
ggaacctatccgccttatacctaccacgatgccagcggcaagctggtcgggtttgatgtc
gatatcgcccgcgccgtggccgccaagatggggctgaagcccgtctttgtcgaggggcgc
tgggacggactgatcgccgggctatcggccaaacgctacgatgcggtgatcaatcaggtc
gggatcaccccggagcgccaggccaagtttgacttctccgatccctacgtgggtgcgaag
gcggtgctgatcgtccgcagcgacaatgcccagctcaaaagctttgacgatctgcgcggg
cagaaagcggcccagagcctcaccagcaactatgccaagctggcggagcactatggcgca
gacctggtgccgaccgacgggttcaaccagtcgctggagctggtgatcagcggccgggcg
gcggcgacgctaaacgataacctctcttatctcgactttcggcagcataagcccaatgcc
cccctcaaggtggtggccgtcgcggatcagcgcgccgactccgcgattctggtgcgtaaa
ggccagccccagctggttgcagcgctgaaccgtgcgctgagcgagatccgcgccgatggc
acgtaccagaccctatctcagcgctacttcggcagcgacgtctctcaataa

DBGET integrated database retrieval system