KEGG   Edwardsiella piscicida C07-087: ETAC_07490Help
Entry
ETAC_07490        CDS       T02509                                 

Definition
(GenBank) Attachment invasion locus protein
  KO
K07804  putatice virulence related protein PagC
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_07490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ail_Lom OMP_b-brl
Motif
Other DBs
NCBI-ProteinID: AGH73619
Position
1695171..1695728
Genome map
AA seq 185 aa AA seqDB search
MKKQIAGLVLGAVGILTAQVAQAGSSTLSLGYAQSKVQNFKNMPGVNLQYRYEWDSALSV
MASLSVLQNDVDSTTHWWGVTSQDHVKARYNSLLIGPAWRLNEAVSLYAAAGMSHSQMAR
DYVSSAGQAPIHYADTVNALAYGGGVLVNLSAHVTANLGYEGSQTRVQGQRRHVNGVNVG
LGYRF
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacagatcgctggactggtattgggcgcggtggggatcctgactgcgcaggtg
gcgcaggccgggagcagtacgctgtcgctgggctatgcgcagagtaaggtacaaaatttt
aaaaacatgcccggcgtgaatctgcagtatcgctatgagtgggactccgcgctgagcgtg
atggcatcgctgagcgtgttgcaaaatgatgtggattcgacgacccactggtggggcgtc
acctcgcaggatcacgtgaaggcgcgctataattctctgctgataggaccggcctggcgg
ctgaatgaggccgtcagcctgtatgcggcggccggaatgtctcacagccagatggcgcgg
gactacgtcagcagcgcggggcaggcgccgattcactatgccgatacggtcaatgccttg
gcctatggcggcggcgtactggtcaacctgagcgcgcacgttacggcgaaccttggctat
gaggggtcgcaaactcgcgtgcaggggcagcgtcgtcacgtgaatggggttaacgtcggt
ctcggctaccgtttttag

KEGG   Edwardsiella piscicida C07-087: ETAC_12850Help
Entry
ETAC_12850        CDS       T02509                                 

Definition
(GenBank) Attachment invasion locus protein
  KO
K07804  putatice virulence related protein PagC
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_12850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMP_b-brl Ail_Lom
Motif
Other DBs
NCBI-ProteinID: AGH74691
Position
complement(2895503..2896075)
Genome map
AA seq 190 aa AA seqDB search
MKKSFCAVSLLISLGAAAPVMAESQTVSLGYAQAKVADFKNIAGVNLKYRYEWDSPLSLM
TSFTYMSGSKAFSESTGLEYSRGNGDLKYYSLAAGPAWRINDSVSVYGLLGVNVNKTTVS
AAWRDVWVGGYEEGSLQQTRSKGSLMYGAGLQINPLANWSIDVGYEGSRVDLGGSKHSIN
GFNLGVGYRF
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagtttttgcgcagtatctctgttgatttccctgggcgccgctgcgccggta
atggccgagagccagacggtttctctgggctatgctcaggccaaggtggctgattttaaa
aatattgccggggttaacctgaaatatcgctatgagtgggactctccccttagcctgatg
acctcctttacctatatgagcggcagcaaggcgttcagtgaaagcacggggctggagtat
tctcgcggtaatggggatctgaaatattactctctggcggcgggcccggcctggcggatt
aatgatagcgtcagcgtttatgggctgctgggggttaacgtgaataagaccacggtctcc
gccgcctggcgcgacgtgtgggtcggcggctatgaagagggcagtctgcagcaaacgcgc
agtaaggggtcgctgatgtacggcgccggtctgcagatcaacccgctggccaactggagc
atcgatgtgggctatgagggatcgcgcgtcgatctgggcggcagcaagcacagcatcaac
ggctttaacctgggtgtcggctaccgcttctaa

DBGET integrated database retrieval system