KEGG   Edwardsiella piscicida C07-087: ETAC_07515Help
Entry
ETAC_07515        CDS       T02509                                 

Definition
(GenBank) Tetrathionate reductase two-component response regulator
  KO
K13041  two-component system, LuxR family, response regulator TtrR
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00514  TtrS-TtrR (tetrathionate respiration) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_07515
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_07515
Two-component system [BR:etc02022]
 LuxR family
  TtrS-TtrR [MD:M00514]
   ETAC_07515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 HTH_23 FleQ HTH_40
Motif
Other DBs
NCBI-ProteinID: AGH73624
Position
complement(1697904..1698527)
Genome map
AA seq 207 aa AA seqDB search
MNTPATVYIVDDDASVRDSLGFILEGYGMAVAAYADGNAFLTGADLTLPGCAILDLRMPG
LSGMQVHQALRERESVLGVIFLTGHGDVPQAVEALRHGACHFLEKPVESDSLLHAISAAQ
RVSLQCSRAALIRQRLARLTQRERQTFDLLCQGLKNQAVADRMHVSLRTVEVHRANISRK
LETASLIAFICQLNAEPAGDICPSASK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaacacacccgctacggtctatatcgtcgacgatgacgcatcggtgcgcgattcactg
ggattcattctcgaaggatacggcatggcggtcgccgcctacgccgacggcaacgcgttc
ctgacgggcgccgatctgaccctgcccggctgcgcgatcctggatctgcgcatgccggga
ctgtctggcatgcaggtgcatcaggccctgcgcgaacgagagagcgtgctcggcgttatc
ttcctgaccggccacggcgatgtcccccaggcggtcgaggccctgcgccacggcgcctgc
cattttctggagaagccggtggagagcgatagcctgctgcacgccatcagcgccgcccag
cgcgtctcccttcagtgctcgcgcgcagctctgattcgacaacgcctggcacgtctgacg
cagcgggagcggcagaccttcgatctgctgtgtcaggggttaaaaaatcaggccgtcgcc
gaccgcatgcacgtctcgctacgcacggtggaggtacaccgcgccaatatcagccgtaag
ctggaaaccgcctcactgatcgcgtttatctgtcagctgaacgccgagcccgcgggcgac
atctgtccatccgcctcaaaatga

DBGET integrated database retrieval system