KEGG   Edwardsiella piscicida C07-087: ETAC_07520Help
Entry
ETAC_07520        CDS       T02509                                 

Definition
(GenBank) Tetrathionate reductase sensory transduction histidine kinase
  KO
K13040  two-component system, LuxR family, sensor histidine kinase TtrS [EC:2.7.13.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00514  TtrS-TtrR (tetrathionate respiration) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_07520
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_07520
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_07520
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ETAC_07520
Protein kinases [BR:etc01001]
 Histidine kinases
  LuxR family [OT]
   ETAC_07520
Two-component system [BR:etc02022]
 LuxR family
  TtrS-TtrR [MD:M00514]
   ETAC_07520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphonate-bd HATPase_c HisKA HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: AGH73625
Position
complement(1698524..1700296)
Genome map
AA seq 590 aa AA seqDB search
MTPLMRYGSPWLALLLLLPARAAPTPPQTVTIGVLATRGTQMAERQWQPLADWLSQRLPA
YRFHLQPYDISALDSAVRQQRLDFVITNPGQAVTLGRHYPLSWLATLKSPQRHGNTNVIG
SALIVRSDSRLRHLADLRGKNISAVSPQAFGGYQTLLYRLAREGYDYRHFFAQTRFAGFP
LDALIYRLRDGETDAVIVPVCQLETMVAEGLIAPGAFRVIDNIAPPDFRCQSSTLLYPNW
SFARTAQASPALAKQVAGALLALPEHHPAAQAAGSRGWSAPESAYSVEQFYRRLEETHPP
GLTLRALRWLQENQAWLWGALGVLLLLTLYHLWLEWRFQRTQRRLLDAEADLNRKRLALE
HAQRVAIVGELGTSLAHELNQPLEAIKNYADGCLLRAERQAPVDTLIPALGHIRQQVSRA
DAIVKRLRSLIRRTPEPSQILAPHDVMDDTLTLLTSERRRHAITLERQLSGTPICGRYDA
VGLQQLLLNLLKNAIEALSTQTPPRRITLDQRYLPQAYRLTIDDNGPGLPGESHRVQQAF
FTTKPDGLGLGLSICQQVTETLGGTLTLENRPQGGCRVTLTLPYPAEETP
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgctgatgcgctacggcagcccatggctggccctgcttttgctgctccccgcc
cgggcggcacccacgccgccgcagacggtgaccattggcgtgctggccacccgcggaacc
cagatggccgagcgtcagtggcagccgctggccgactggctcagtcagcgactgcccgcc
tatcgcttccacctgcagccctatgacatcagcgcgctggacagcgccgtgcgtcagcag
cggctggatttcgtgattaccaatcctggacaggcggtcacgttgggacggcactacccg
ctctcctggctggcgaccctgaaaagcccgcagcgccacggcaataccaacgtcatcgga
tctgcgctgatcgtgcgcagcgacagccgcctgcgccacctggccgatctgcgcggcaaa
aatatcagcgccgtctcgccccaggcctttggcggctaccagacgctgctctaccgcctg
gcgcgcgaaggctatgactaccgccacttcttcgcccaaactcgctttgccggctttccg
ctggatgcgctgatctaccgcctgcgcgatggtgaaaccgacgccgtgatcgtgccggtc
tgccagctggaaaccatggtggccgaaggactgatcgcccccggcgcctttcgggtcatc
gataatatcgccccgcccgactttcgctgccagagcagcaccctgttgtaccccaattgg
tcatttgcccgcaccgcgcaggccagccccgcgctggccaaacaggtcgccggggcgctg
ttggccctgccggaacatcacccggcggcccaggccgccggatcgcggggctggagtgcg
ccggagagcgcttacagcgtcgaacagttttaccggcgcctggaggagacccatcccccc
ggccttaccctgcgcgccctgcgctggctacaggagaaccaggcctggctgtggggcgcg
ctgggggtgctgctgctgctgaccctgtaccacctgtggctggagtggcgcttccagcgt
acccagcggcgcctgctggacgccgaggcggatctcaaccgtaagcgcctggcgttagag
cacgctcagcgcgtcgccatcgtcggagagctgggcaccagtttggcccatgagctcaac
cagccgctggaggcgatcaaaaactatgccgacggctgcctgctgcgggcggagcggcag
gcccccgtcgatacgctgatccccgcgctgggacacatccgccagcaggtcagccgggcc
gacgccatcgtcaagcgcctgcgcagcctgatccgccgcacgccagagcccagccagatc
ctggccccccatgacgtcatggacgataccctgaccctgctgaccagcgagcggcgccgc
cacgctatcacgctagagcgacagctcagcggaacgccgatctgcgggcgctacgacgcc
gttggactgcagcagctgctgcttaacctgctgaaaaatgccattgaggcgctatccacc
cagacgccgccgcgccgcatcacgctcgatcagcgctatcttccgcaggcctaccggctc
actatcgacgacaacggcccaggtcttcccggcgagagtcaccgcgtccagcaggccttt
tttaccaccaagcccgatggcctcggcctggggctctccatttgccagcaggtcaccgag
acgctcggcggcaccctgacgctggagaaccgcccgcagggcggctgtcgggtcaccttg
acccttccctatccggcggaggagacgccatga

DBGET integrated database retrieval system