KEGG   Edwardsiella piscicida C07-087: ETAC_07525Help
Entry
ETAC_07525        CDS       T02509                                 

Definition
(GenBank) Tetrathionate reductase subunit B
  KO
K08358  tetrathionate reductase subunit B
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00920  Sulfur metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ETAC_07525
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_07525
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_07525
Transporters [BR:etc02000]
 Other Transporters
  Transmembrane electron carriers [TC:5]
   ETAC_07525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Fer4_7 Fer4_10 Fer4_9 Fer4 Fer4_2 Fer4_6 Fer4_3 Fer4_17 Fer4_8 Fer4_21 Fer4_4
Motif
Other DBs
NCBI-ProteinID: AGH73626
Position
1700489..1701253
Genome map
AA seq 254 aa AA seqDB search
MQDDKQQQRRRLLLGIGSVSAGLALLPWGEALAAQSPAETASRQGMRGKRWAMIIDLRKC
VGCQACTVACCMENLPPIGQFRTTVKQYEVSGAAANGVSQMFMLPRLCNHCENPPCVAVC
PVQATYQRDDGIVMVDNRRCVGCAYCVQACPYDARFINQQTLTADKCTFCAHRLEAGLLP
ACVESCVGGARIIGDMHDPDSTLSRLLAQHRASVYVLKPEQHTAPRVFYLGLDAAFVSQV
SGQAALYGDEEIGE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatgacaaacaacaacagcggcggcgcctgctgttagggatcggcagcgtcagc
gccggtctggcgctgctgccgtggggggaggcgctggcggcgcagtcgccggcggagacg
gcgtcgcgacagggaatgcgcggtaagcgttgggcgatgattatcgacctgcgtaagtgc
gtcggctgccaggcctgcacggttgcctgctgcatggagaacctgccgcccatcggccag
tttcgcaccacggtaaagcagtatgaggtcagcggcgccgcggcaaacggcgtcagccag
atgttcatgctgccgcgcctgtgtaatcactgtgaaaatccgccctgcgtcgcggtctgc
ccggtgcaggcgacctatcagcgcgacgatggcatcgtgatggtggataaccggcgctgc
gtcggctgcgcctactgtgttcaggcctgcccgtacgatgcccgttttatcaatcagcag
acgctgaccgccgataaatgcaccttctgcgcccaccgtctggaggcggggctgttgccc
gcctgcgtcgagtcctgcgtcggcggggcgcgcatcatcggcgatatgcacgatcccgac
agcaccctgagccgcctgctggcgcagcatcgggcgtcggtttatgtactgaagccggag
cagcatacggcgccgcgggtgttctacctggggctcgacgccgcgtttgtcagccaggtc
agcgggcaggcggcgctgtacggtgatgaggagataggcgaatga

DBGET integrated database retrieval system