KEGG   Edwardsiella piscicida C07-087: ETAC_07530Help
Entry
ETAC_07530        CDS       T02509                                 

Definition
(GenBank) tetrathionate reductase complex subunit C
  KO
K08359  tetrathionate reductase subunit C
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00920  Sulfur metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ETAC_07530
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_07530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_07530
Transporters [BR:etc02000]
 Other Transporters
  Transmembrane electron carriers [TC:5]
   ETAC_07530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NrfD
Motif
Other DBs
NCBI-ProteinID: AGH73627
Position
1701250..1702305
Genome map
AA seq 351 aa AA seqDB search
MISEILVAPQPVAWLPWAVQYFFYIGSAYGAALLLWLALRRRDSYSVTFIRAMALVLLIS
CVVGPLALTADLHQPGRAWHFFAYLTPGSWMSRGALLLPLFSLLGVVTGWLCLRPALQEA
ARTRWSPLLILLAAGRWSAAPALVRLCALLTVLSGASIALYTGSEVGIVAARPLWHQWML
PWLWLCSAPLASVGLWALVRGLLDQPVTATDRRLLRAVICSAALASLLLLACWLFWPTGR
VGAEGLSFMRAQAWPAALLLLLTLAASRWLAQRRWPVALLAIGAAASLRWLTLIDVQRVP
RYDAGIYPYTLAIGSEGWLGILAMAGLWVCLAAILTELIEARADAVEQQNG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcgagatcctggtagcgccgcagccggttgcctggctgccgtgggcggtgcag
tactttttttatatcggcagtgcctatggcgcggcgctgttgctgtggctggcgctgcgg
cgtcgcgatagttacagtgtcacatttattcgcgcgatggcgctggtgctgctgatctcc
tgcgtggtcgggccgctggcgctgacggccgatctgcatcagcccggtcgtgcctggcac
ttttttgcctatctaacgcccggctcatggatgtcgcgcggcgcgctgctgctgccgctg
ttctccctgctgggcgtcgtcaccgggtggctctgcctgcgtcccgcgctgcaggaggcg
gcgcggacgcgctggagccccctgctgatcctgttggctgcggggcgctggtctgcggcg
ccggcgctggtgcgcctctgcgccctgttgaccgtgctgtccggcgccagcatcgccctg
tataccggcagcgaggtcgggatagtggcggcgcgtccgctgtggcaccagtggatgctg
ccgtggctgtggctgtgcagcgcgccgttggccagcgtggggctgtgggcgctggtgcgc
ggcctgctggatcagccggtcacggcgaccgatcggcgtctgctgcgcgcggtgatctgc
agcgccgcgctggcgagcctgctgttgctggcctgctggctattctggcccacggggcgg
gtcggggcggaggggctttcgtttatgcgtgcacaggcgtggcccgccgcgctgttgctg
ctgctgacgctcgcggcgtcgcggtggctggcgcagcggcgctggccggtcgccctgttg
gccatcggcgcggcggcctcgctgcgctggctgaccctgatcgacgtacagcgggtcccc
cgctatgacgcggggatttacccttacacgctggcgatcggcagcgaggggtggctgggg
atcctggccatggcgggactgtgggtttgcctggcggcgatcctgactgaactgattgag
gcgcgcgctgacgcggtggagcaacaaaatggataa

DBGET integrated database retrieval system