KEGG   Edwardsiella piscicida C07-087: ETAC_07570Help
Entry
ETAC_07570        CDS       T02509                                 

Definition
(GenBank) methylmalonate-semialdehyde dehydrogenase
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00280  Valine, leucine and isoleucine degradation
etc00410  beta-Alanine metabolism
etc00562  Inositol phosphate metabolism
etc00640  Propanoate metabolism
etc01100  Metabolic pathways
etc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ETAC_07570
   00562 Inositol phosphate metabolism
    ETAC_07570
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ETAC_07570
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ETAC_07570
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     ETAC_07570
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     ETAC_07570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AGH73635
Position
1714311..1715816
Genome map
AA seq 501 aa AA seqDB search
METVANFIQGECVTGSGQRVQAIFNPATGEQIRRVAMSTVQETEQAIAAAARAFPAWAHQ
SPLKRARVMFRFKALLEQHMETLARLISEEHGKVYSDAVGELTRGLEVVEFACGIAQLQK
GEHSANVGSGVDSYSLMQPLGVCAGITPFNFPAMVPMWMFPIALATGNTFVLKPSEKAPS
LALALAKLLQEAGLPDGAFNVVQGDKASVDVLLMDPRIQAVSFVGSTPVAEYIYQTASAH
GKRCQALGGAKNHCILMPDADMDMATSAIMGAAYGAAGERCMALSVVLAVGDNVADELCA
RLASQIAALRVGPGLDQTPENEMGPLISAAHRSKVLGYIDSGEAQGATLRVDGRRFHVNG
YEQGYFVGPTLFDNVAADMDIYQEEIFGPVLSVVRVADYNSAIAWINRHEYGNGAAIFTR
DGGCARRFCDEAQAGMVGVNVPIPVPMAFHSFGGWKRSIFGPLNVHGSDGVRFYTRMKTV
TARWPERQQDSGAAFSMPTLA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggagacggtagcgaattttattcagggcgagtgtgtcaccggttcaggccagcgcgtg
caggcaatcttcaacccggccaccggtgaacagatccgccgcgtggcgatgagcacggtg
caggaaacagagcaggccattgccgccgccgcccgggcgttccccgcctgggctcatcag
tcgccgctaaagcgcgcgcgggtgatgtttcgctttaaagcgctgcttgagcagcatatg
gagacgctggcccggctgatcagcgaagagcatggcaaggtgtactctgatgcggtgggg
gagctgactcgcggtcttgaggtggtcgagttcgcctgtgggatagcgcagctgcaaaag
ggagaacactctgccaacgtgggatccggtgtcgatagctactcgctgatgcagccgctg
ggcgtttgcgccgggatcacgccgttcaacttccctgcaatggtgccgatgtggatgttc
cccatcgcgctggcgaccggcaacacctttgtgcttaaaccgtcagagaaagccccttcg
ctggcgctggcattggcgaaactgctgcaggaggccgggttgccggacggtgcgttcaac
gtcgtgcagggcgataaagcgtccgttgatgtcctgctgatggatccgcgcattcaggcc
gtgagctttgtcggctcgacgccggtggctgagtatatttatcagaccgcatccgcgcac
ggcaaacgctgtcaggcgctcggtggggcaaaaaaccactgcatcctgatgccggatgcg
gatatggacatggcgaccagcgctatcatgggcgccgcgtacggcgcggcgggtgagcgc
tgcatggcgctctccgtggtgttggcggtgggtgataacgtagccgatgagttatgcgcg
cggttggcgagccagattgccgcgctgcgggtcggcccagggctcgaccaaacgccggag
aatgagatggggccgctgatctcagccgctcatcgcagcaaggtgttgggctatatcgac
agcggcgaggcgcagggcgcgacgctgcgcgttgacggccgccgctttcacgttaacggt
tatgaacaggggtatttcgtcggcccaacgctattcgataacgtggccgccgacatggac
atttaccaagaggagatttttggcccggtgctttcggtggtgcgggttgccgattataac
agcgcgatagcgtggattaaccgtcatgaatacggtaacggcgcggccatttttacccgc
gacggcggctgcgcgcgccgtttctgcgatgaggctcaggcggggatggtcggcgtcaac
gttcctattccggttcccatggcgtttcacagcttcgggggctggaagcgatctattttt
ggtccgctcaatgtacacggtagtgatggggtacgcttttacacccggatgaaaacggtg
accgctcgctggcccgaaagacagcaggatagcggcgccgcattctctatgccgacgctg
gcttga

DBGET integrated database retrieval system