KEGG   Edwardsiella piscicida C07-087: ETAC_07585Help
Entry
ETAC_07585        CDS       T02509                                 

Definition
(GenBank) periplasmic binding protein/LacI transcriptional regulator family
  KO
K17208  inositol transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00592  Inositol transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_07585
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_07585
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Inositol transporter [MD:M00592]
    ETAC_07585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_3 Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: AGH73638
Position
1719055..1719984
Genome map
AA seq 309 aa AA seqDB search
MKKLIFAALIAVTSGAAQAENEQIVFSTPNLAMPFEVHMQRTAVNAAKAMGVKLQILDGQ
GSSPKQVADLENAITRGAQGFIVSPNDVNAVSGAVDEIQSVSLPVVTLDRSVDSQNKVPH
FGANNYKGGLAIGDFVKAKFPRGADIILLTGQPGSSSNIERSKGIRDSLKAGGEQYRIVT
DQTGNWMRSEGMRIVESVLPALAKRPQVILSANDDMALGAIEALQSQGLQPGDVLVTGFD
AVPEALARVRDGWMAVTADQRPGYAVQTAMSQLVANVREKQAIVGADYPPTLITRENLQQ
AERINEAGN
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgatctttgccgctctcatcgccgtgacatccggagcggcccaggctgag
aacgagcagattgttttcagtacgccaaatctggcgatgccgtttgaagttcacatgcag
cgcacggcggtcaacgccgccaaggcgatgggggtgaagctgcagatattggacgggcag
ggcagttcgccaaagcaggtggctgatcttgaaaacgccatcacccgcggcgcacagggg
tttatcgtgtcgcccaatgacgttaacgccgtttccggcgcggttgatgagatccagtcc
gtcagtctgcccgtggtgaccctcgaccgctccgtcgacagccagaataaggtgccgcac
ttcggcgcaaataactacaaaggcggcctggccatcggtgactttgtgaaggctaaattc
ccccgcggcgcggacattattctgctgaccgggcagccgggctcctcgtctaacatcgag
cgtagcaaggggatccgcgacagcctgaaggcggggggcgagcagtaccggatcgtcacc
gatcagaccggtaactggatgcgatctgaagggatgcgcattgtcgagagcgtcctgccg
gcgctggccaagcgtccgcaggtgatcctctctgccaacgatgatatggcgctgggcgcg
attgaagcgctgcagagtcagggactccagccgggcgatgtgctggtgacgggatttgac
gccgtgccggaggccctggcgcgggtgcgcgacggttggatggcggtgacggccgatcag
cgtccgggctatgcggtgcagacagcaatgagccagttggtggctaacgtgcgtgagaag
caggcgatcgttggcgcagactatccgccgacgcttatcacccgtgaaaacctgcagcag
gccgagcggattaacgaggccggtaactga

DBGET integrated database retrieval system