KEGG   Edwardsiella piscicida C07-087: ETAC_07590Help
Entry
ETAC_07590        CDS       T02509                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K17210  inositol transport system ATP-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00592  Inositol transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_07590
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_07590
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Inositol transporter [MD:M00592]
    ETAC_07590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 Dynamin_N RsgA_GTPase AAA_23 AAA_30 AAA_16 AAA_27 AAA_25 AAA_22 MMR_HSR1 DUF2813 AAA_15
Motif
Other DBs
NCBI-ProteinID: AGH73639
Position
1720036..1721583
Genome map
AA seq 515 aa AA seqDB search
MSQPLLNVTHLAKSFSGVWALSSVQLTVGAGEIHALLGENGAGKSTLLKALAGAQPQTSG
EIWFNGALLPVEDSPVERQNKGIITIYQEFNLLPNMTVAENMFLGREPRKRNLIVDEKAV
NQEAQVILRYLQLNVAPTTPVARLSVAQQQMVEIARALTLNAKLIIMDEPSAALSDSEVD
SLHRVVRELRARGVSIIYVTHRLHEVFQLCDNFTVFQDGRFTGTGAVADTTVEQLIRLMV
GRDVAFNRRPPSETHHDDKPVRLAVKGLCREKPPLDPHGIALHDISFHVHAGEVLGIAGL
VGAGRTEVARCLFGADGFTSGQLELDGVAYQPHSPLYALAQGIALVPEDRKKEGAVLGLS
IRDNLSLSCLSSLLRWRYFVNTRKEDALIATYRQALQIKMVSSDQAVRKLSGGNQQKVIL
ARCMALNPRVLIVDEPTRGIDVGTKSEVHQVLFDMAKQGVAVIVISSDLPEVMAVSDRII
TLSEGRVTGEIHGDDATEEHLMMMMAINHNALNAA
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaacctttactcaacgttacccatctggcgaaaagcttctccggcgtctgggcg
ctgagcagcgtgcagctgaccgttggcgcaggtgaaatccacgcgctgctgggggaaaac
ggcgcggggaaatccacgctgttgaaggcgctggccggggcgcagccgcagacgagcggc
gaaatctggtttaacggcgccctgctgccggtggaggactcgccggtcgagcggcagaac
aagggcattattactatctatcaggaatttaacctgctgcccaatatgaccgtcgcggaa
aatatgttcctcggccgcgagccgcgtaagcgcaatctgatcgtcgatgaaaaggcggtg
aaccaggaggcgcaggtgatcctacgctacctgcagctcaacgttgcgccgacgacgccg
gtggcgcgcctgagcgtggcacagcagcaaatggtggagatcgcccgcgcgctgacgctg
aatgccaaactgatcattatggacgagccgtccgcggcgctgagcgacagcgaagtggac
agcctgcaccgggtggtgcgggagctaagagcgcgtggggtgagcattatttatgtcacc
caccgcctgcacgaggtgtttcagctctgcgacaactttaccgtgtttcaagacggccgc
tttaccggcaccggtgcggtggcggacaccaccgtagagcagttgatccgcctgatggtc
gggcgcgacgtggcgttcaaccgccgtcctcccagcgaaacccaccatgacgataaaccc
gttcgcctcgcggtgaaaggactgtgccgtgaaaagccaccgttggatccgcacggtatc
gcgctacatgacatcagtttccacgttcacgcaggtgaggtgctgggtatcgccgggctg
gtcggcgccgggcgtaccgaagtggcccgctgcctgttcggcgccgacggctttacctct
ggccagcttgagctcgatggcgtggcctaccagccgcacagcccgctgtatgcccttgct
caggggattgcgttggtgccagaggatcgcaaaaaagagggggcggtgctggggctgtct
attcgcgacaacctgtcgctttcctgcctctcttcgctgctgcgctggcgctattttgtg
aacacccgtaaagaggatgcgctgattgccacttaccgtcaggcgctgcagatcaaaatg
gtgagcagcgatcaggcggtacgcaagctctccggcggcaaccagcagaaagtcattctt
gcgcgctgtatggcgcttaatcctcgggtgcttatcgtggatgagccgacgcggggcatt
gatgtcggcaccaagtcagaagtgcatcaggtgctgtttgatatggctaagcagggcgtg
gcggtgatcgtgatttcgtccgacctgccagaggtgatggcggtgtccgatcgcattatt
accctcagcgaaggtcgggtgacgggcgaaattcacggtgatgatgccaccgaagagcac
ctcatgatgatgatggccatcaatcacaacgccctgaacgcggcataa

DBGET integrated database retrieval system