KEGG   Edwardsiella piscicida C07-087: ETAC_07595Help
Entry
ETAC_07595        CDS       T02509                                 

Definition
(GenBank) amino acid or sugar ABC transport systems, permease protein
  KO
K17209  inositol transport system permease protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00592  Inositol transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_07595
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_07595
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Inositol transporter [MD:M00592]
    ETAC_07595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2 ODV-E18
Motif
Other DBs
NCBI-ProteinID: AGH73640
Position
1721595..1722623
Genome map
AA seq 342 aa AA seqDB search
MTQMTSKTPTPVTRPGRFDPIAFFERFGVLIFMILLLIFFQSQNGNFFSERNIVNILTEV
SIYGIMAVGMTFVILTAGIDLSVGSILAVCAMTAAYVIKGDNFTTVDVSAWGGMSWLIGL
GICLSMGTAIGFLHGLGVTRLRLPPFIVTLGGMTIWRGLTLVINDGAPIAGFDPGYRWWG
RGELLGISIPIWIFALVAMGGYLALHKTRWGRFVYAIGGNPEAARLAGVNVKRVLVSVYV
LIGCLAGLAGFILSARLGSAEAVAGISFELRVIASVVIGGTSLMGGYGRIGGTIIGSIIM
GILINGLVLMNVSAYYQQIITGLIIILAVAFDTYAKSRRGAL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagatgacttccaaaacgccgacaccggtaacgcgcccgggacgtttcgatcct
atcgccttcttcgagcgcttcggggtgctgatttttatgatcctgttgctgattttcttc
cagtcgcagaacggcaattttttctctgagcgcaatatcgtcaatattctgaccgaggta
tccatctacggaatcatggcggtgggcatgacgtttgtcatcctgaccgcaggaatagat
ctgtccgtcggctccatcctagcggtctgcgccatgaccgcggcgtacgttatcaaaggt
gacaatttcactaccgttgatgtcagcgcctggggcggtatgagctggctgattgggctg
gggatctgtctgtcgatgggtacggcgattggttttctgcatggcctcggcgtgacccgc
ctgcgcctgccgccgtttatcgtcaccctcggtgggatgaccatctggcgtgggctgacg
ctggtgattaacgacggtgccccgatcgccggttttgaccccggttaccgctggtggggg
cgcggcgagttgctcggtatctctattcctatctggatctttgcgctggtggccatgggc
ggctatttagcgctgcataaaacgcgctggggccgctttgtgtatgccatcggcggtaac
ccggaggccgcgcgcctggccggggtcaacgtcaaacgcgtgctggtgagcgtctatgtg
ctgatcggctgtctggcagggctggcgggttttatcctcagcgcgcgtctggggagcgcc
gaggcggtcgccgggatctcgtttgagctgcgtgtgattgcctcggtggtgattggcggg
acgtcgctgatgggcggctatggccgcatcggcggcaccattatcggctcgatcattatg
ggtatcctgattaacggtctggtgctgatgaacgtgtcagcctactaccaacaaattatt
accgggctaattatcatactggccgtcgcttttgacacctatgccaagagccgtcgcggc
gcactgtga

DBGET integrated database retrieval system