KEGG   Edwardsiella piscicida C07-087: ETAC_07620Help
Entry
ETAC_07620        CDS       T02509                                 

Gene name
malS
Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00500  Starch and sucrose metabolism
etc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ETAC_07620 (malS)
Enzymes [BR:etc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ETAC_07620 (malS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase ParD_like Tmp39
Motif
Other DBs
NCBI-ProteinID: AGH73645
Position
1727626..1729563
Genome map
AA seq 645 aa AA seqDB search
MKYAVFAALLLPLAAGADWRSPAFPQFVAVDEGRFSASQPLAKGEAPRWRLFRDGRYQAL
VDTRSGTPTLTLSVHDEAAQRAAAAARRCPRWDGRPLRVPVDRAFSEGSLVRDFYSGEVA
RVTQGTVTLQPAPGSNGLLLLELAETAGPAPFDWHNATVYFVLVDRFANGDPSNDNSYGR
QKDGMQEIGTFHGGDLRGLTGQLDYLQRLGVNVLWISSPLEQIHGWVGGGSRGDFPHYAY
HGYYPLDWTRLDANMGSEQDLRALVEGAHRRGIRVLFDVVMNHTGYATLADMQQYQFGAL
FLQGETLRQTLGTHWRDWRPGRGQTWHSFNDYIDFGNRAAWARWWGKGWIRTDIGDYDAP
GFDDVTLSLSFLPDVKTESSAASGLPIFYRHKPDTRAREIPGYTPRDYLTHWLSQWVREY
GIDGFRIDTAKHVEPAAWQQLKQQASAALAEWKRANPQQALDDAPFWMTGEAWGHGVMRS
AYYRHGFDAMINFDYQEQAARAQGCLADIDPLWQQMAAQLQDFNVLSYLSSHDTRLFRSD
GSGAAALLLLAPGAVQIFYGDESGRPLGPTGSDPLQGTRSDMNWQDIRGSAAAQVAHWQR
LGQFRARHPAIGKGEQTTVAMPQGYGFIRNDGRDRVMVVWAGQPE
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacgccgttttcgccgcactattgctgccgttggccgccggggccgactggcga
tcgcccgcgtttccccagttcgtcgccgtggacgaggggcgctttagcgccagtcagccg
ctggccaaaggcgaggcgccgcgatggcggctcttccgggatggccgctaccaggctcta
gtcgatacccgctcgggaacgccgacgctgacgctgtccgtacacgatgaggccgcgcag
cgggcggcggcggcggcgcgtcgctgtccacgttgggatgggcgtccgctgcgcgtaccg
gtcgatcgggcctttagtgaaggcagcctggtgcgcgatttttacagtggagaggtcgcc
cgcgtcacccagggcacggtgaccctgcagccggcgccgggcagcaatggcctgctgctg
ctcgaattggctgaaaccgcggggccggcgccgttcgactggcacaacgcgacggtctat
tttgtcctggtcgatcgcttcgccaacggcgatcccagcaacgataatagctatggtcgc
cagaaggacgggatgcaggagatcgggacctttcacggcggcgatcttcgcgggctgacc
ggccagctcgactatctccagcgtctgggggttaatgtcctgtggatcagctcgcccctt
gagcagatccacggctgggtcgggggcggtagtcggggcgacttcccgcactatgcctat
catggttactacccgctggactggacgcggctggatgccaatatgggcagcgagcaggat
ctgcgggcgctggtggagggggcccaccggcgcggtatccgagtgctgttcgacgtggtg
atgaaccataccggctatgcgacgctggcggatatgcagcagtaccagttcggcgcgctg
ttcctgcagggggagacgctgcggcaaacgctgggcacccattggcgcgactggcggccg
gggcgcggccagacgtggcatagctttaatgactatattgatttcggcaatcgcgcggcg
tgggcgcgctggtgggggaaggggtggatccgtaccgatatcggcgactatgatgccccg
ggattcgatgatgttacgctgtcgctctcttttctgccggatgtgaagaccgagtctagc
gcggcgtccggtttgccgattttttatcgtcataagccggatacccgcgcccgggagatc
cccggctacacgccgcgagactacctgacccactggctcagtcagtgggtgcgtgaatac
ggcatcgatggctttcgcatcgacacggcaaagcacgtagagccggcggcctggcaacag
ctgaagcagcaggccagcgcggccttggccgaatggaagcgggctaatccgcagcaggcg
ttggacgatgcccccttctggatgaccggcgaggcctgggggcacggcgtgatgcgcagc
gcctattatcgtcacggcttcgatgcgatgatcaattttgactatcaggagcaggcggcg
cgggcgcagggctgtctggccgatatcgatccgctgtggcagcagatggcggcgcagctg
caggattttaacgtgctgagctatctgtcgtcccatgatacccgtctgtttcgcagcgac
ggcagcggcgccgctgcgctgctgctgctggcgccgggcgcggtgcagattttctacggc
gatgagtcggggcgtccgctggggccaacgggatccgatccgctgcagggcacccgttcg
gatatgaattggcaggatatccgcggctcggcggcggcgcaggtcgcgcactggcagcgc
ctggggcagttccgcgcccgccatcccgctatcggcaagggggagcagacgaccgtcgcg
atgccgcagggctacggctttatccgcaatgatgggcgggatcgggtgatggtggtctgg
gccggtcagccggagtag

DBGET integrated database retrieval system