KEGG   Edwardsiella piscicida C07-087: ETAC_07640Help
Entry
ETAC_07640        CDS       T02509                                 

Definition
(GenBank) sensor kinase CusS
  KO
K07644  two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC:2.7.13.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00452  CusS-CusR (copper tolerance) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_07640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_07640
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_07640
   01504 Antimicrobial resistance genes [BR:etc01504]
    ETAC_07640
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ETAC_07640
Protein kinases [BR:etc01001]
 Histidine kinases
  OmpR family
   ETAC_07640
Two-component system [BR:etc02022]
 OmpR family
  CusS-CusR [MD:M00452]
   ETAC_07640
Antimicrobial resistance genes [BR:etc01504]
 Gene sets
  beta-Lactam resistance modules
   Imipenem resistance, repression of porin OprD [MD:M00745]
    ETAC_07640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_5 HATPase_c_2 DUF3325
Motif
Other DBs
NCBI-ProteinID: AGH73649
Position
complement(1737242..1738705)
Genome map
AA seq 487 aa AA seqDB search
MSTKRTRRPISLAARLTLTISLATSLAFAAFTWIMIYSVERHFAELDNATLQQVRSSVLR
VLQEPPRAGVQRLDTLSRVLAGYPNISVALRAGDHGFRYRYRADAAAADLDAVWQLPTLP
RHLHNGQVFLWPNDDHAAGPREAAAQNAYRLIATTVYPAGDPRTPYTLLIALSINVHLHY
LEQLKSNLMICAAVISLLIIFIVLLAVYSGHRPLRDLSGKIKAITAENLDTRLAPDAVPI
ELRQLVLSFNQMLARIEDVFTRQANFSADIAHEMRTPITNLITQSEIVLSQTRTQSELEE
VIYSNLEEYQRMAKMVNDMLFLAQADSQRLRLSRVPLDLRQETLKVFDFFEAWAEERQVT
LRMDGKGPAAWGDPAMLRRVISNLLSNAIRHTPAGHRVTVHLSETADAVRLCVANPGAPI
AARHLPRLFDRFYRVDPARQRNGEGSGIGLAIVKSIIAAHQGQIWVSSDADATRFTVSLP
RAAGGDK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactaagcgcacgcggcgccccatctccctggcggcccgcctgaccctcaccatc
tcgttggcgaccagcctcgccttcgccgcgttcacctggatcatgatctactccgtcgaa
cgccatttcgccgagctggacaacgccacgctccaacaggtgcgcagcagcgtcctgcgc
gtcttgcaagagccgccccgcgccggcgtccagcgcctcgataccctcagccgcgtgctg
gccggctaccccaacatcagcgtcgcgctgcgcgctggcgaccacggttttcgctatcgc
taccgcgcggacgccgccgccgccgatctcgacgcggtctggcagctgccgacgctgccg
cgccatctgcacaacgggcaggtctttctgtggccaaacgacgaccacgccgctggccct
cgcgaggcggcggctcaaaacgcctaccgcctcatcgccaccacggtctacccggcgggc
gatccgcgcaccccctataccctgctgatcgccctctccatcaacgtacacctgcactat
cttgagcagctgaagagcaatctgatgatctgcgcggccgtcatcagcctgctgatcatt
ttcatcgtgctgctcgccgtttacagcggacatcgaccgctgcgcgatctcagcgggaag
atcaaggccatcaccgccgagaatctcgatacccgcctcgcccccgacgcggtgccgatc
gagctgcggcagctggtgctctccttcaaccagatgctcgcccgcatcgaggacgtcttc
acccgacaggcaaacttttctgccgacatcgcccacgagatgcgcaccccgatcaccaac
ctgatcacccagagcgaaatcgtgctgagccagacccggacccagagtgaactggaggag
gtaatctattcgaaccttgaagagtatcagcggatggcgaagatggtgaacgacatgctg
tttctggcgcaggcggacagtcagcgccttcgcctcagccgcgtccccctcgacctgcgc
caggagaccctcaaggtgtttgacttcttcgaggcctgggcggaggagcgccaggtcacc
ctgcgcatggatggcaaggggcccgccgcctggggcgatcccgcgatgctgcggcgggtc
atcagcaatctgctgtccaacgccattcgccacaccccggcgggccaccgcgtgaccgtg
cacctcagcgagacggccgacgcggtgcggctctgcgtcgccaatcccggcgcgcccatc
gccgcgcggcacctgccgcgcctgttcgaccgtttctaccgcgtcgaccccgcgcgtcag
cgtaacggcgaggggagcggcatcggcctggccatcgtcaaatcgatcatcgccgcgcat
cagggccagatctgggttagctcggacgccgacgccacccgctttaccgtctccctgcct
cgcgccgcgggtggcgacaagtaa

DBGET integrated database retrieval system