KEGG   Edwardsiella piscicida C07-087: ETAC_07645Help
Entry
ETAC_07645        CDS       T02509                                 

Definition
(GenBank) DNA-binding transcriptional activator CusR
  KO
K07665  two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00452  CusS-CusR (copper tolerance) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_07645
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_07645
   01504 Antimicrobial resistance genes [BR:etc01504]
    ETAC_07645
Two-component system [BR:etc02022]
 OmpR family
  CusS-CusR [MD:M00452]
   ETAC_07645
Antimicrobial resistance genes [BR:etc01504]
 Gene sets
  beta-Lactam resistance modules
   Imipenem resistance, repression of porin OprD [MD:M00745]
    ETAC_07645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C Response_reg
Motif
Other DBs
NCBI-ProteinID: AGH73650
Position
complement(1738695..1739378)
Genome map
AA seq 227 aa AA seqDB search
MKILIVEDEVKTGKYLCKGLTEAGFVVDLADNGLTGYHLAMTAGYDLIILDILLPDVNGW
EIVRMLRSANQGLPILLLSALGTIEQRVKGLELGADDYLVKPFAFAELLARVRTLLRRGS
PPIPESQFHVADLTVELLSRKVTRGGKRITLTGKEFTLLTFFIRHQGEVLPRSLIASQVW
DMNFDSDTNAIDVAVKRLRAKIDLDFEPKLIQTVRGVGYLLEAPDVD
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatactgatcgtcgaggatgaggtgaaaaccgggaaatacctgtgtaaggggcta
acagaggcgggatttgtcgtcgatctcgccgacaacggtttaacgggataccacctggcg
atgaccgccggctatgatctgatcatccttgatatcctgctgcccgacgtcaacggctgg
gagatcgtccgcatgctgcgcagcgccaaccagggactgccgatcctgctgctgagcgcc
ctcggcaccatcgagcagcgggtaaaggggctggagctcggcgccgacgactacctggtc
aagcccttcgccttcgccgagctcttggcgcgggtgagaaccctgctgcgacgcggcagc
ccccctatccccgagagccagtttcacgtcgccgatctcaccgtggagctcctttccaga
aaggtgacccgcggcggtaagcgcatcacgctaacggggaaagagttcaccctgctgacg
ttttttatccgtcaccagggcgaggtgctgccccgctccctgatcgcctcgcaggtctgg
gacatgaacttcgacagcgacaccaacgccatcgacgtggccgtgaagcggctgcgggcg
aagatcgacctcgacttcgaacctaagctgatccagacggtgcgcggcgtgggctacctg
ctcgaggcgccggatgtcgactaa

DBGET integrated database retrieval system