KEGG   Edwardsiella piscicida C07-087: ETAC_07650Help
Entry
ETAC_07650        CDS       T02509                                 

Definition
(GenBank) copper/silver efflux system outer membrane protein CusC
  KO
K07796  outer membrane protein, Cu(I)/Ag(I) efflux system
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_07650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_07650
Transporters [BR:etc02000]
 Other Transporters
  Pores ion channels [TC:1]
   ETAC_07650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OEP Glutaredoxin2_C Baculo_LEF5_C
Motif
Other DBs
NCBI-ProteinID: AGH73651
Position
1739579..1740961
Genome map
AA seq 460 aa AA seqDB search
MVRIKQLSVSVVLALTGCVSLAPEYQRPALPVGAQFSSSPSATGAATTHYQDRGWRPFFR
DAQVRQLIDDALRNNRDLRQAVISVRLARAQWALQEADRYPQLDAAAQANSRAPLRGGAS
DREYQLGGALGVELDLFGRLQSMSAREQQNVLASQQAQRAVHILLVANVAQAYFTQQLAY
AQRRIAQETLQSYRHSYALIEQQVRAGGANLLALEQARGQIDSTQATLARREGDVAQANH
AIQRLVGVYDGAPRDRRGLESSVGPVALPVPLPSTILLQRPDIMEAEHQLRAADADIGAA
RAAFFPTISLSGGLNASGSDLAGLFSAAGGMWSFVPKITLPIFNGGRNRATLQLAELRQQ
QSIVNYENKIQAAFKEVDDALSTRRSLAEQLTAQQRYLDALQATVGRARGLYAHGALSYL
EVLDAERALFTTQQTLLDLRYAQQANEIALFAALGGGWQA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggttaggataaagcagttaagcgtcagcgtggtcttggctctgacggggtgcgtctcc
ttggcgccagagtatcagcgcccggcattgccggtaggcgcgcagttctcatcgtcgccg
tcggccaccggtgcggcgacgacgcactatcaggatcggggctggcgcccgttctttcgc
gatgcgcaggttaggcagctgatcgacgatgcgctgcgcaacaaccgcgacctgcggcag
gcggtgatctctgtgcggctggcgcgcgcgcagtgggcgctgcaggaggccgaccgctat
ccccagctcgatgccgccgcccaggcgaactcccgcgcgccgctgcggggcggcgctagc
gatcgggaatatcagctgggcggcgcgctgggggttgagctggatctgttcggccgactc
cagtcgatgagcgcgcgggagcagcagaacgttctcgccagccagcaggcgcagcgcgcg
gtgcatatcctgttggtcgccaatgtcgcacaggcctattttacccagcagttggcctac
gcccagcggcgtatcgcgcaggagacgctgcagagctatcgccactcctacgctctgatc
gaacagcaggtgcgggccggcggcgccaacctgctggcgctggagcaggcgcgtgggcag
atcgacagcacccaggcgacgctagcgcggcgtgagggagacgtggcgcaggccaaccat
gccatacagcggctcgtcggcgtctatgacggcgcgccccgcgatcggcgcgggctggag
agctcggtcggcccggttgcgctgccggtgccgctgccatcgacgatcctgctgcagcgc
cccgacatcatggaggcggagcatcagctgcgggcggcggatgccgatatcggcgcggcc
cgggcggcgttctttcccacgatctcgctgagcggcggcctgaacgccagcggcagcgat
ttggccggattattcagcgcggccggtgggatgtggagctttgtccccaagattacgctg
cccatctttaacggcgggcgtaaccgcgccactctgcagctcgccgaattacgccagcag
cagtccatcgtgaactatgaaaataagatccaggcggcgtttaaggaggtggacgatgcc
ctctctacgcgccggagcctcgccgagcaattaacggcgcagcagcgctatctcgacgcg
ctgcaggcgaccgtagggcgcgcccgcggcttatacgcccacggcgcgctgagctatctc
gaggtattggacgccgagcgcgcgttatttaccacccagcagacgctgctcgatctgcgc
tatgcccagcaggcgaacgagatagcgctttttgccgccctgggcggcggttggcaggca
taa

DBGET integrated database retrieval system