KEGG   Edwardsiella piscicida C07-087: ETAC_07655Help
Entry
ETAC_07655        CDS       T02509                                 

Definition
(GenBank) Cation efflux system protein cusF
  KO
K07810  Cu(I)/Ag(I) efflux system periplasmic protein CusF
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_07655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CusF_Ec MlaD YbgS
Motif
Other DBs
NCBI-ProteinID: AGH73652
Position
1740994..1741341
Genome map
AA seq 115 aa AA seqDB search
MKTMIKVTLCAALVMASGAPALAAQSAHQHDQAMAADLSAAPQITTRGEVKAIDLQSNKI
TLSHPAIPEVDWPAMTMRFTFDQESQVAGLKVGDRVTFSFVQQGAISRLTAIHVI
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgatgattaaagtaactttatgcgcggcgttggtcatggcgagcggtgccccg
gcgctggcggcgcagagcgcccatcagcacgaccaggcgatggccgccgatctttctgcg
gcgccgcagatcacgacccgcggcgaggtgaaggcgatcgatctgcagagtaacaagatc
actctcagccatccggcgatacccgaagtggactggccggcgatgaccatgcgctttacg
ttcgaccaggagagccaggtggcggggctaaaggtcggcgatcgggtgacgttttcattt
gttcagcaaggcgcgatctctcggttgaccgccattcatgtcatctga

DBGET integrated database retrieval system