KEGG   Edwardsiella piscicida C07-087: ETAC_07660Help
Entry
ETAC_07660        CDS       T02509                                 

Definition
(GenBank) copper/silver efflux system membrane fusion protein CusB
  KO
K07798  membrane fusion protein, Cu(I)/Ag(I) efflux system
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_07660
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_07660
Transporters [BR:etc02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   ETAC_07660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_D4 HlyD_3 HlyD
Motif
Other DBs
NCBI-ProteinID: AGH73653
Position
1741439..1742752
Genome map
AA seq 437 aa AA seqDB search
MPALNIKYAAALAGGLILGAAITVALYPYLNLTSSATATSAPAERRVLFWYDPMKPDVKF
DQPGKSPFMDMDLVPKYADEGGDAGQESGVRIDPAQRQNLGLKTATVRRGTLRDALTLPA
TISFNEYQYAIVQARAEGFVEKVYPLTNGDRIARGSPLVDITLPAWVEAQSEYLLLSPSG
GDQAAQRQGVLERLRLSGMPEEDIQRLRTARRIQTRFTLRAPIDGVITAFDLRAGMNFSK
DKTVAQIQGIDPVWVSAALPEAMAAQLNADSRFELAVPAYPQQRFSVRDWRTLPSADPTT
RTLQIRLAVANPDGRLKPGMNATLRLETQSPPLLLIPAQAIVDSGDEQHVITVTQDGRFL
PKRVAVAQEAQQQAGIAAGLTEGESVVVNGLFLIDSEASISGALARMRQASAGETASSAV
APEPIASHVGHGDARHD
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctctaaatataaagtatgccgcggcgcttgccggcggccttattctgggtgcg
gcgatcaccgttgccctgtatccatatctgaatctgacgtcgtcagccaccgcgacgtcg
gcgcccgccgaacgccgcgtactattctggtatgacccgatgaagcccgatgtcaaattc
gatcagccgggtaaatccccctttatggacatggatctggtaccgaaatacgccgacgag
ggcggcgacgcggggcaagagagcggggttcgcatcgatcccgcccagcggcagaatctg
gggctgaagacggccacggtgcgccgggggacgctgcgcgacgccctgacgctgcccgcc
accatcagctttaacgagtatcaatacgcgatcgtgcaggcgcgcgcggaggggtttgtc
gagaaggtctacccgttgaccaacggcgatcgtatcgcgcgcggcagcccgctggtcgat
atcaccctcccggcctgggtcgaggcgcagagcgaatatctgctgctgagcccatcgggg
ggggatcaggcggcgcagcgccagggcgttctggagcgcctgcgcctgagcgggatgccg
gaagaggatattcagcgcctgcgcaccgcgcggcgcatccagacgcgctttactctgcgc
gcgccgatcgacggggtgatcaccgccttcgatctgcgcgccgggatgaacttctccaag
gataagacggtggcgcagatccagggtatcgacccggtctgggtcagcgccgcgctgccg
gaggcgatggccgcgcagctgaacgcggatagccgcttcgagctggcggtgccggcctat
ccacagcagcgcttctcggtgcgcgactggcgcacgctgcccagcgccgatccgacgacg
cgcaccctgcagattcgcctggcggtggcgaatcccgacggcaggctgaagcccgggatg
aacgccacgctgcgtcttgagacgcagagcccgccgctgctgctgatccccgcccaggcg
atcgtcgatagcggcgacgagcagcatgtgatcaccgtgacgcaggacgggcgcttcctg
ccgaagcgcgtcgcggtggcgcaggaggcgcagcagcaggcggggatcgccgcggggctg
acggagggagagtcggtggtggtcaacggcctgttcctgatcgactcggaggccagtatc
agcggggcgctggcgcgtatgcgtcaggcgagcgcgggggagaccgcctcatctgccgtc
gcaccggagcccatcgcgtcgcacgtcggacacggagacgcacgccatgattga

DBGET integrated database retrieval system