KEGG   Edwardsiella piscicida C07-087: ETAC_07665Help
Entry
ETAC_07665        CDS       T02509                                 

Definition
(GenBank) Cobalt-zinc-cadmium resistance protein CzcA; Cation efflux system protein CusA
  KO
K07787  Cu(I)/Ag(I) efflux system membrane protein CusA/SilA
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_07665
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_07665
Transporters [BR:etc02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ETAC_07665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran MMPL
Motif
Other DBs
NCBI-ProteinID: AGH73654
Position
1742745..1745912
Genome map
AA seq 1055 aa AA seqDB search
MIEWIIRRSVANRFLVMMGVLFLSLWGGWTIANTPVDALPDLSDVQVIIKTSYPGQAPQL
VEDQVTYPLSTTMLSVPGAKTVRGFSQFGTSYVYVIFADGTDLYWARSRVLEYLNQVQGK
LPAGVSAEIGPDATGVGWIFEYALLDKHGRHDLAELRSLQDWFLKYELKTIPNVAEVASV
GGVVKQYQIQVDPLKLAQYGVRLAEVKQAVGSSNQEAGGASLELAEAEYMVRASGYLRTL
DDVNHIVLKSGPDGVPVYLQDVARVQIGPEMRRGIAELNGEGEVAGGVVILRSGENARQV
ITAVKAKLAALQGSLPPGVEVVTTYDRSQLIDRAIDNLSAKLIEEFIVVALVCALFLWHV
RSALVAIVSLPLGLCIAFIIMRYQGLNANIMSLGGIAIAVGAMVDAAIVMIENAHKRLEE
WAHRHPERPIDNATRWRVITDAAVEVGPALFISLLIITLSFIPIFTLEGQEGRLFGPLAF
TKTYAMAGAAALAIVVIPILMGFWIRGDIPPESRNPLNRFLIRVYHPLLLAVLRWPRLTL
LAAALSMVTVIWPLERIGGEFLPNINEGDLLYMPSTLPGISPAQAAQLLQTTDKLIRQVP
EVASVFGKSGKAESATDSAPLEMIETTIQLKPQDQWRPGMTMDKIIAELDATVRLPGLAN
LWVPPIRNRIDMLSTGIKSPIGIKVSGTVLADIDATAQRIEAVAKGVPGVVSALAERLEG
GRYIDIQIQRQRAARYGMTVGDVQLFVSSAIGGAMVGETVEGVARYPIAIRYPQAWRNSP
EALRQLPILTPLKQQITLGDVAEVRVVSGPTMLKTENARPASWIYIDARGRDMVSVVEDL
KTAIQRQVTLAPGTSVSFSGQFELLEHANRKLMLMVPMTLVIIFVLLYLAFRRVEEALLI
LMSLPFALVGGIWFLYWQGFHLSVATGTGFIALAGVAAEFGVVMLMYLRQAIEQDPALSH
AERFTPAALDEALYHGAVLRVRPKAMTVAVIIAGLLPILWGSGAGSEVMSRIAAPMIGGM
ITAPLLSLFIIPAAYKLIWLRRHHLGASRAADPRE
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atgattgaatggattattcgacgctcggtggcgaaccgtttcctggtgatgatgggcgtc
ctgttcctcagcctctggggcggttggaccatcgctaacacgccggtggatgcgctgccc
gacctctccgacgtccaggtgatcatcaagaccagttacccggggcaggccccgcagctg
gtggaggatcaggttacctatccactgagcaccaccatgctgtcggtgccgggcgccaag
acggtgcgcggcttctcccagttcggcacctcctatgtctatgtgatcttcgccgatggc
accgacctctactgggcgcgctcgcgtgtattggagtacctgaatcaggtgcagggcaag
ctgccggcgggggtcagcgcggagatcgggcccgatgccaccggggtcggctggatcttc
gagtatgcgctgctggataagcacgggcggcacgatctggccgagctgcgctcgctgcag
gattggttcctgaagtatgagctgaagaccatccccaacgtcgccgaggtcgcctcggtc
ggtggggtggtgaagcagtatcagatccaggtcgatccgctgaagctggcgcagtacggc
gtccgtctggcggaggtgaagcaggccgtcggctcatccaaccaggaggcgggcggcgcg
tcgctggagctggccgaggcggagtatatggtgcgggccagcggctacctgcgcaccctc
gacgatgtgaaccacatcgtcttaaagagcggcccggatggcgtgccggtctatctgcag
gacgttgcgcgggtccagatcgggccggagatgcgccgggggatcgccgagctgaacggc
gagggcgaggtggccggcggggtggtgatccttcgctcgggtgagaatgcccgtcaggtg
atcacggcggtgaaggcgaagctggccgcactgcagggcagtctgccgccgggggtggag
gtggtgacaacctatgaccgcagccagctgatcgatcgggccatcgataacctgagcgcc
aagctgatcgaggagtttatcgtggtggcgctggtctgcgccctgtttctgtggcacgta
cgctcggcgctggtggcgatcgtctccctaccgctggggctgtgcatcgcctttatcatc
atgcgttaccaggggctgaacgccaatatcatgtcgctgggggggatcgccatcgcggtg
ggggcgatggtcgatgcggcgattgtgatgatcgagaacgcccataagcgtctggaggag
tgggcgcatcgtcatcccgagcgtcctatcgacaacgcgacccgctggcgggtgatcacg
gatgccgcggtcgaggtggggccggcgctgtttatcagcctgctgatcatcacgctctcc
ttcatcccgatctttaccctcgaagggcaggaggggcggctgttcggcccgctggccttc
accaagacctacgccatggccggcgcggcggcgctggcgatcgtcgtcatcccgatcctg
atggggttctggatccggggcgatattccgccggagagccgtaatcccctgaaccgtttt
ctgatccgcgtctatcacccgctgctgcttgccgtgctgcgctggccgcggctcaccctg
ctggcggcggcgctgtcgatggtgacggtgatctggccgctggagcgcatcggcggcgag
tttttgccgaacatcaatgagggcgatctgctgtacatgccctcgacgctgccggggatc
tcgccggcccaggcggcgcagctgctacagaccacggataagctgatcaggcaggtgcca
gaggtggccagcgtctttggtaagagcgggaaggcggagagcgcgaccgactcggcgccg
ctggagatgatcgagaccaccattcagctgaagccgcaggatcagtggcgtccgggaatg
acgatggacaagatcatcgccgagctcgacgccacggtgcgcctgccggggctggccaac
ctgtgggttccgccgatccgcaaccgcatcgacatgctctccaccggcatcaagagcccg
atcggcatcaaggtatcgggcaccgtgttagccgacatcgacgccacggcccagcgtatc
gaggcggtggcgaagggggtccccggggtggtctcggcgctggcggagcgcttggaggga
gggcgctacatcgatattcagatccagcgccagcgggccgcccgctatgggatgacggta
ggcgacgtgcagctgtttgtctcatcggccatcggcggggcgatggtcggcgagaccgtc
gaaggggtggcgcgctacccgattgcgatccgctatccccaggcgtggaggaactcgccc
gaggcgctgcgtcagctgccgatcctgacgcccctaaagcaacagatcaccctgggggat
gtggccgaggtgcgcgtggtctccgggccgacgatgctgaagacggagaatgcccgtccg
gccagctggatctatatcgatgcccgcgggcgcgatatggtctcggtggtcgaggatctg
aagacggcgatccagcgccaggtcaccctggcgccgggcaccagcgttagcttctccggt
cagttcgagctgctggagcacgccaaccgcaagctgatgctgatggtgccgatgacgctg
gtgatcatcttcgtactgctctatctggcctttcggcgggtagaagaggcgctgctgatc
ctgatgagcctgcccttcgccctggtgggcggcatctggttcctctactggcaggggttc
catctgtcggttgccaccggcaccggctttatcgccctggccggcgtggccgccgagttt
ggcgtggtgatgctgatgtacctgcgccaggccattgagcaggatccggcgctgagccac
gccgagcgctttaccccggccgcgctggatgaggcgctgtaccacggcgcggtgctgcgg
gtgcgccccaaggcgatgaccgtggcggtgatcatcgccggtctgctgccgattctgtgg
ggaagcggggcgggctccgaggtgatgagccgcatcgcggcgccgatgatcggcgggatg
atcaccgcgccgctgctgtcgctgttcatcattccggcggcctataagctgatctggctg
cgtcgccatcacctcggcgcgtcccgcgcggccgatccgcgcgagtga

DBGET integrated database retrieval system