KEGG   Edwardsiella piscicida C07-087: ETAC_07815Help
Entry
ETAC_07815        CDS       T02509                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00670  One carbon pool by folate
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc01200  Carbon metabolism
Module
etc_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ETAC_07815
Enzymes [BR:etc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     ETAC_07815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: AGH73684
Position
complement(1775461..1777191)
Genome map
AA seq 576 aa AA seqDB search
MISRCEPMPSSQPALQPIAAVAARIGIASEALIPYGHYAAKVDMRKLTPRPSRGKLILVS
SITPTPLGEGKTVTTLGLSQGLNHLGHSAIACIRQPSLGPVFGVKGGAAGGGASQVLPME
QLNLHLTGDIHAISAAHNLAAAALDARLFHEQRLGDAFSDQSGLPRLDIDPQRIVWKRVM
DHNDRALRSIDVGVGGGNNGVPRHDGFDISAASELMAILALSESLADMRLRIGKVILAYS
LQGAPITAEDLQVAGAMTVVMKEAIHPTLMQSSEQTPVLIHAGPFANIAHGNSSVLADRL
ALQLADYVVTEAGFGSDMGMEKFFNIKYRQSGIAPSCVVLVATLRSLKANSGQFNMKPGQ
ALPEEVKQPNADLLRAGCENLGWHIANARRYGLPVVIAVNRWPEDTPQELAILRDYALSA
GAFGVEFSEAFALGGRGAARLAACVTDACSQAAQVTLLYPDEMPLADKLQTLAHSYGASH
AELTAQAQQELEALAQAGFGHLPLCMAKTPLSISADPALKNAPRDFVLPIRSLQVSAGAG
FIRAYAGNIMTMPGLSTLPAYRHIDIDADGNTVGLS
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgatatcccgctgcgaaccgatgccttcatctcagcctgccctgcagccgatcgccgcc
gttgccgcccgaatcggcatcgcctctgaagccctgatcccctatggccactatgcggcc
aaggtggatatgcggaagctcacgccccgcccgtcccgcggtaaactgatcctggtctcc
agcatcacccccacgccgctcggcgaagggaaaaccgttacgaccctcggcctgagccaa
gggctgaaccatctggggcacagcgccatcgcctgtatccgccagcccagcctcggcccg
gtattcggcgtcaagggcggcgccgccggcggcggtgcgtcgcaggtgctgccgatggag
cagctcaatctgcacctgaccggcgatattcacgctatcagcgccgcccataacctggcc
gcggcggcgctcgatgcccgtctgttccatgagcagcgcctgggcgacgcgttctccgac
cagagcgggctgccgcgtctggatatcgacccccagcgcatcgtctggaagcgggtgatg
gatcataacgatcgggcgctgcgcagcatcgacgttggcgtcggcggcggcaataacggc
gtgccgcgccacgatggctttgacatcagcgccgcctcggagctgatggccattctggcg
ctctccgagagcctggccgatatgcgtctgcgcatcggtaaggtgatcctggcctattcc
ctgcagggcgcgccgatcaccgcggaggatctgcaggttgccggtgccatgaccgtcgtg
atgaaagaggcgatccacccgaccctgatgcagagcagcgagcagacgccggtgctgatc
cacgcgggcccctttgccaatatcgcccacggcaactcctctgtgctggccgatagactg
gccctgcagctggccgactatgtggtcaccgaggcgggctttggctccgacatgggcatg
gagaagttcttcaatatcaaatatcgccagtcggggatcgccccctcctgcgtggtgctg
gtcgccacgctgcgcagcctgaaagccaacagcgggcagttcaatatgaagccgggacag
gcgctgccggaagaggtcaagcagccgaacgccgatctgctgcgcgccgggtgtgaaaac
ctgggctggcacatcgccaacgcccgccgctacggtctgccggtagtgatcgccgtcaac
cgctggccggaggatacgccgcaggagctggccatactgcgcgactatgcgctgagcgcc
ggcgccttcggcgtcgagttcagcgaagcctttgccctcggcgggcgcggcgcggcgcgc
ctggcggcctgtgtcaccgacgcctgcagccaggcggcccaggtcacgctgctgtatccg
gacgagatgccgctggcagacaagctgcagaccctggcgcacagctacggcgccagccac
gccgagctgacggcgcaggcgcagcaggagctggaggcgctggcgcaggccggctttggc
cacctgccgctgtgcatggcgaagactccgctctccatcagcgccgatccggcgttgaaa
aatgccccgcgcgactttgtgctgcccatccgcagtctgcaggtctccgccggcgccggg
tttattcgcgcctacgccggtaacatcatgacgatgccggggctcagcaccctgccagcc
taccgccacatcgatatcgacgccgacggcaataccgttggcctgagctaa

DBGET integrated database retrieval system