KEGG   Edwardsiella piscicida C07-087: ETAC_07845Help
Entry
ETAC_07845        CDS       T02509                                 

Definition
(GenBank) fumarate hydratase
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00020  Citrate cycle (TCA cycle)
etc00620  Pyruvate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ETAC_07845
   00620 Pyruvate metabolism
    ETAC_07845
Enzymes [BR:etc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     ETAC_07845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 FumaraseC_C G-alpha
Motif
Other DBs
NCBI-ProteinID: AGH73690
Position
1783425..1784828
Genome map
AA seq 467 aa AA seqDB search
MTAMRIESDAMGQVKVPQERMWGAQTQRSLAHFRISVEKMPPALITALALVKLCAARVNR
EAGRLTPEKADAIMLAAQEVIDGQRAGEFPLSVWQTGSGTQTNMNMNEVLANRASELLGG
VRGEQRLVHPNDDVNSAQSSNDVFPTAMHVATVLGIERDLLPRIAQLSDTLRHKAQCFAS
IVKIGRTHLQDATPLTLGQEISGWVAMLEHSGQHIRHALPHLYELALGGTAVGTGLNTPP
GFAQRVAAQIAEQSGLPFVSAPNKFEALATCDALVQGHGALKGLACSLMKIANDVRWLAS
GPRCGIGELRLPENEPGSSIMPGKVNPTQCEALTMVCAQVLGNDTAVNIGGASGNFELNV
FRPLVIHNVLQSLRLLADGMESFNQHCAQGLMPNRERIDELLQRSLMLVTALAPHIGYDR
AAEIAKRAHREGTTLREAALALGYVSAQAFDQWVQPAQMVGSVAQGD
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgatgcgtatagagagcgacgcgatgggacaggtgaaggttcctcaggaacgg
atgtggggcgcccagacgcagcgctctctggcgcatttccgtatctcggtagaaaagatg
ccgccggcgctgattacggcgctggcgctggtcaagctgtgcgccgcgcgcgtcaacaga
gaggccgggcgcctgacgccggagaaggcggacgccattatgctggcggcgcaggaggtt
atcgacggtcagcgcgccggggagtttccgctgtcggtctggcagacgggatccggtacg
cagaccaatatgaatatgaacgaagtgctggcgaaccgggccagtgagctgctggggggt
gtccgcggcgagcagcggttggtgcatcccaatgatgacgtcaatagtgcccaaagctcc
aacgatgtgtttccaacggcgatgcacgtggcgacggtgctgggcattgaacgcgatctg
ctgccgcggatcgcccagctgagcgataccctgcggcataaggcgcagtgcttcgcctcc
attgtgaagattggacgcacccatctgcaggatgccacgccgctgacgctggggcaggag
atctccggctgggtggcgatgctggagcatagcgggcaacatatccgccacgcgctgccg
cacctgtacgagctggcgctggggggaacggcggtcggaaccgggctgaatacgccgccg
ggctttgcccagcgcgtcgccgcgcagatcgccgaacagagcggtctgccgttcgtcagc
gcccccaataagttcgaggcgctggcgacctgtgatgccctggtgcagggacacggtgcg
ctgaaggggctggcctgctccctgatgaagatagccaacgacgtgcgctggctggcctct
gggcctcgctgtgggataggggagctgaggctgccggagaatgagccgggcagctccatc
atgcccgggaaggtcaacccgacgcagtgtgaggcgctgaccatggtgtgcgcgcaggtg
ctggggaatgatacggcggtgaatatcggcggcgcctccggtaactttgagctgaatgtc
tttcgtccgctggtgatccacaatgtcttacagtcgctgcgcctgttagccgacggtatg
gagagctttaaccagcactgtgcgcagggactgatgccgaatcgggagcgtatcgatgaa
ctgctgcagcgttcgctgatgctggtgacggcgttggccccgcacatcggctacgatcgg
gcggcagagatcgccaagagggcgcaccgagaggggacgacgctgcgggaggcggcgctg
gcgctcggctacgttagcgcgcaggcgtttgaccaatgggttcaacccgcgcagatggtg
gggagcgtcgcacagggcgactga

KEGG   Edwardsiella piscicida C07-087: ETAC_10045Help
Entry
ETAC_10045        CDS       T02509                                 

Definition
(GenBank) Fumarate hydratase class I
  KO
K01676  fumarate hydratase, class I [EC:4.2.1.2]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00020  Citrate cycle (TCA cycle)
etc00620  Pyruvate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ETAC_10045
   00620 Pyruvate metabolism
    ETAC_10045
Enzymes [BR:etc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     ETAC_10045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fumerase_C Fumerase
Motif
Other DBs
NCBI-ProteinID: AGH74130
Position
complement(2278687..2280333)
Genome map
AA seq 548 aa AA seqDB search
MSNKPFHYQDPFPLQGDDTDYYLLSKEHVSVVSFEGQDMLKVEPQALTLLAQQAFHDASF
MLRPAHQRQVAAILDDPQASENDKYVALQFLRNSEIAAKGVLPTCQDTGTAIIVGKKGQR
VWTGGGDAEALSRGVYNTYIEDNLRYSQNAALDMYNEVNTGTNLPAQIDLYATEGEEYKF
LCVAKGGGSANKTYLYQETKALLTPEKLKAFLIEKMRTLGTAACPPYHVAFVIGGTSAES
TLKTVKLASTKYYDALPTEGNEHGQAFRDVALEQELLLAAQALGLGAQFGGKYFAHDVRV
IRLPRHGASCPVGMGVSCSADRNIKAKINREGIWIEKLEHNPGKYIPEHLRQAGEGEAIK
VDLNRPMKEILAQLSQYPVSTRLSLSGTIIVGRDIAHAKLKALLDEGKPLPQYVKDHPIY
YAGPAKTPAGHASGSLGPTTAGRMDSYVDLLQANGGSMIMLAKGNRSQQVTDACHKHGGF
YLGSIGGPAAVLAQQSIKSLTCVAYPELGMEAIWKIEVEDFPAFILVDDKGNDFFQQILS
SRCSGCMK
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaataaacccttccattatcaagatccgtttccgctgcaaggcgatgacaccgac
tattatctgctgagcaaggagcatgtctccgtggtcagctttgaaggccaggatatgctg
aaggtcgagccgcaggcgctgacgctgttggcccagcaggcgttccacgacgcctcgttt
atgctgcgcccggctcatcagcgccaggtcgccgcgattcttgacgatccgcaggccagc
gaaaacgataaatacgtcgcgctgcagttcctgcgtaactccgagatcgccgccaagggg
gtactgccgacctgtcaggacaccgggacggcgattatcgtgggtaaaaaaggccagcgc
gtgtggaccggcggcggcgatgccgaggcgctgtcgcgcggggtttataacacctatatc
gaagataacctgcgctactcccagaatgccgcgctggatatgtataacgaggtcaatacc
ggaaccaacctgccggcgcagatcgacctgtacgccaccgagggcgaggagtacaaattc
ctgtgcgtcgccaaaggcggcggttcagccaataaaacctacctgtatcaggagaccaag
gcgctgctgacgccggagaagctgaaggctttcctgatcgagaagatgcgtaccctgggt
accgcggcctgtccgccgtaccacgtggccttcgttatcggcggtacgtcggcggagtct
acgctgaagacggtgaagctggcgtcgaccaagtactatgatgcgctgccgaccgagggc
aatgagcacggccaggcgttccgcgatgtggcgctggagcaggagctgctgctggcggcg
caagcgctggggctgggtgcacagttcggcggcaaatactttgcccacgacgtgcgggtg
atccgcctgccgcgccacggcgcctcctgtccggttggcatgggggtttcctgctcggcg
gatcgtaatatcaaggccaagattaaccgcgaggggatctggatcgagaagctggagcat
aacccaggtaaatatattcctgagcatctgcgccaagccggcgagggggaggccatcaag
gtggatctcaaccgtccgatgaaggagatcctggcgcagctctcccagtatccggtctct
acccgtctgtcgctctccggtaccatcatcgtcgggcgtgatatcgcccacgccaagctg
aaggcgctgctggacgaaggcaagccgctgccgcagtatgtgaaggatcacccgatctac
tacgcaggcccggccaagacgccggcgggccatgcctctggctcactggggccaaccacg
gcaggccgtatggactcctatgtcgacctgctgcaggccaacggcggcagcatgatcatg
ctggccaaagggaaccgcagccagcaggtcaccgacgcctgccataaacacggtggcttc
tatctgggcagcatcggtggcccggcggcggtactggcccagcagagcatcaagagcctg
acctgcgtggcctatcctgagctggggatggaggctatctggaagattgaggtagaagac
ttcccggccttcatcctggtggatgacaagggaaatgacttcttccagcagattttgagc
agccgctgcagtggctgcatgaaataa

DBGET integrated database retrieval system