KEGG   Edwardsiella piscicida C07-087: ETAC_08050Help
Entry
ETAC_08050        CDS       T02509                                 

Definition
(GenBank) DNA-binding transcriptional regulator RstA
  KO
K07661  two-component system, OmpR family, response regulator RstA
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00446  RstB-RstA two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_08050
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_08050
Two-component system [BR:etc02022]
 OmpR family
  RstB-RstA [MD:M00446]
   ETAC_08050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C Response_reg
Motif
Other DBs
NCBI-ProteinID: AGH73731
Position
1832623..1833345
Genome map
AA seq 240 aa AA seqDB search
MSRIVFVEDDPDVGQLIAAYLGKHDIDVTLEPRGDTAFDTIIRLKPDLVMLDIMLPGKDG
MSLCRDLRPAYAGPIVLLTSLDSDMNHILSLEMGASDYILKTTPPAVLLARLRLHLRQHA
TPLPESTRAAPASSARLNPLQLGQLCIDPVNREVRLGSAEVHLSTSDFDLLWELATHAGT
IMDRDALLQNLRGVSYDGLDRSIDVAISRLRRKLNDTGPEPVRIKTVRNKGYLFAPNAWE
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaattgtatttgttgaggatgatcccgacgtaggccagctgattgccgcctat
ctggggaaacatgacattgatgtcacgctggagccgcgcggcgataccgcctttgacacc
atcattcggctaaagccggatctggtgatgctggatatcatgctaccggggaaagatggc
atgagcctatgccgggatttgcggccggcctacgcggggcccatcgtgctgctgacctcg
ctcgacagcgatatgaaccatatcctgtcgctggagatgggcgccagtgactatattctg
aaaacgacgccgccggcggtgctgctggcgcgcctgcgtctgcacctgcgccagcatgcg
acgccgctgccggaaagtacgcgcgccgcgccggcgtcgtcggcccgactcaatccgctg
cagctcggtcagctctgtatcgatccggtcaaccgcgaggtgcgcctcggcagcgcggag
gtgcatctctccacctccgattttgacctgctgtgggagctggcaacccacgccggcacc
attatggatcgcgatgccctgctgcagaatctgcgcggcgtcagctatgacggtctggat
cgcagcatcgatgtggccatctcccgtctgcgccgcaagctgaacgataccgggccggag
cccgtgcgcatcaagaccgtacgcaataagggatacctgtttgcgcctaacgcctgggaa
tag

DBGET integrated database retrieval system