KEGG   Edwardsiella piscicida C07-087: ETAC_08055Help
Entry
ETAC_08055        CDS       T02509                                 

Definition
(GenBank) sensor protein RstB
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00446  RstB-RstA two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_08055
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_08055
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_08055
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ETAC_08055
Protein kinases [BR:etc01001]
 Histidine kinases
  OmpR family
   ETAC_08055
Two-component system [BR:etc02022]
 OmpR family
  RstB-RstA [MD:M00446]
   ETAC_08055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_5 HATPase_c_2 HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: AGH73732
Position
1833351..1834661
Genome map
AA seq 436 aa AA seqDB search
MRKLFIQFYLLLFVCFLVMAMLVGLVYKVTAERAGRQSMDDLMKSSLYLIRSQLREIPPR
DWNKTIDKLDWNLSFQFHIEPLGKRHLSPGQDRKLREGEIVALDSEYIFLQRIPRSHYVL
AVGPIPYLFFLHEMRLFDFALMLLIGLSLALPVFLWMRPHWQDLLRLENAAQRLGEGHLQ
ERTHFDSTSSLHRLGVAFNRMADNINTLIASKKQLIDGIAHELRTPLVRLRYRLAMSDSL
SAEEQAAINRDIGQLEGLIDELLTYARLDRPQVSTHLEAIDLPAWLEDKANELRQMHPQQ
QILLDIPHRGDFGAIDIRLFERLLDNLINNALRYSQGKLRIGLWFDGDNGCLQVEDDGPG
IPAAERERVFEPFVRLDPSRDRATGGCGLGLAIVYSIVQAYQGQIAISSSSLGGACFLFT
WPRHSATLPSAPAASA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaactgttcattcagttctacctgctgctgttcgtctgctttctggtgatggcc
atgctggtcgggctggtctataaggtcaccgccgagcgcgccggccgtcagtcgatggat
gatctgatgaaaagctcgctgtatctgatccgcagccagctgcgtgagatcccgccgcgc
gattggaacaagaccatcgacaaactcgactggaatctgtcgtttcagtttcatatcgag
cctctcggcaagcgccatctctcacccggacaggatcgtaaactgcgtgagggcgagatc
gtcgccttggacagcgagtacatttttttacagcgcattccgcgcagccactatgtcctg
gcggtcgggccaatcccctacctgttttttctgcatgagatgcgcctgtttgattttgcc
ctgatgctgcttatcggactctcgctggcgctgccggtatttctgtggatgcgcccccac
tggcaggatctgctcaggctggagaacgccgcccagcgcctgggcgaagggcacctgcag
gagcgcacgcacttcgacagcacctccagcctgcatcgcttaggggtcgcgtttaaccgc
atggccgacaacatcaataccctgatcgccagtaaaaagcagctgattgacggcattgcc
cacgagctgcggacgccgctggtgcgcctgcgctaccggctggccatgagcgatagcctc
agcgccgaggagcaggcggcgattaaccgggatatcggccagctggaggggctgatcgat
gagctgctgacctatgcacgcctcgatcgcccgcaggtcagcacccatctggaggcgatc
gacctgcccgcctggctggaggataaggccaatgagctgcgccagatgcatccccagcag
cagatcttgctggatatcccccatcggggcgatttcggcgctatcgatatccgcctgttc
gagcgtctgctggataacctgatcaacaacgccctgcgctatagtcagggcaagctccgt
atcgggctgtggtttgacggtgataatggctgcctccaggtggaggacgacgggcccggt
attcccgccgccgagcgcgagcgggtcttcgaaccctttgttcgactggatcccagccgc
gatcgcgccaccggcggctgtggcctgggtctggccatcgtctacagtatcgtacaggct
tatcagggacagatcgcaattagcagctcgtcgctgggcggcgcctgtttcctgtttacc
tggccgcgtcatagcgctacgctcccatcggcgcccgccgcctcagcctga

DBGET integrated database retrieval system