KEGG   Edwardsiella piscicida C07-087: ETAC_08170Help
Entry
ETAC_08170        CDS       T02509                                 

Definition
(GenBank) Pyruvate-flavodoxin oxidoreductase
  KO
K03737  pyruvate-ferredoxin/flavodoxin oxidoreductase [EC:1.2.7.1 1.2.7.-]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00020  Citrate cycle (TCA cycle)
etc00620  Pyruvate metabolism
etc00650  Butanoate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_08170
   00020 Citrate cycle (TCA cycle)
    ETAC_08170
   00620 Pyruvate metabolism
    ETAC_08170
   00650 Butanoate metabolism
    ETAC_08170
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     ETAC_08170
    1.2.7.-  
     ETAC_08170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N POR EKR PFOR_II Fer4_7 Fer4_16 TPP_enzyme_C Fer4 Fer4_9 Fer4_6 Fer4_21 Fer4_10 Fer4_17 Fer4_8 Fer4_2 Transketolase_C Fer4_18
Motif
Other DBs
NCBI-ProteinID: AGH73755
Position
1856368..1859898
Genome map
AA seq 1176 aa AA seqDB search
MITIDGNSAVASVAYRASEVIAIYPITPSSGMAEQASAWSADGRPNVWGDIPRVVEMQSE
GGAIAAVHGALQTGALATSFTSSQGLLLMIPTLYKLAGELTPFVLHVAARTVATHALSIF
GDHSDVMAVRQTGCAMLCAASVQEAQDFALIAHIASLNSRLPFIHFFDGFRTSHEINKIV
PLADDTLQTLLPAQAIAAHRTHALTPEHPVIRGTSANPDTYFQAREASNPWYDAAYDHVA
DAMQAFADQCGRRYQPFEYDGDPEATRVIVVMGSACGTCAEVCDMLRARGEKVGVLKVRL
YRPFSARHLLAALPLSAQRIAVLDRTKEPGALGEPLYLDVIAALAQAVSSGERAALPLTI
GGRYGLSSKEFGPDCALAVFEALETPRPRPRFTVGINDDVTHLSLPRRTDVHPVSNRLEA
LFYGLGSDGTVSAAKNNIKIIGNSTPLHAQGYFVYDSKKAGGLTVSHLRVRETPIHSAYL
VEQADFIGCHQWQFIERYQMVERLRLGGIFLLNTPYAADEAWARLPQEVQALLNARQAKF
YVLNAARIARECRLGARINTVMQMAFLHLSDLIPNGGALPLLQDAIARSYANKGQEIVER
NWQALGAVEGALHAVPLRPVDAESPRRPPIVADQAPDFVKTVTAAMLAGLGDSLPVSAFP
PDGTWPVGTTRWEKRNIAEAIPIWQPALCTQCNHCVAACPHAAIRAKVVAPAALEHAPAT
LESLEVRARDLRGERYVLQVAPEDCTGCNLCVTVCPAADRQDPSVKAINMQPRLAHLARE
KAHYDAFLALPEIDRRRLERIDIRTSQLISPLFEYSGACSGCGETPYIKLLTQLFGDRML
IANATGCSSIYGGNLPTSPYTTDAQGRGPAWANSLFEDNAEFGLGFRLSAQQHRQRALRL
LHALAGQLPEALVAALQQEETPTETRRQQIAALRAALATLDDPQAQALAQTADALVEQSI
WLIGGDGWAYDIGFGGLDHVLSLSENVNVLVLDTQCYSNTGGQQSKATPLAAVTKFGEHG
KRKARKDLGVSIMMYGHVYVAQISLGAQLNQTVKALQEAESYPGPSLVIAYSPCEEHGYD
LADSHEQMKRLTANGFWPLYRVDPRRGAEGQNALALDSRPPSGDLAQTLLAEQRFRRLNS
LAPQEAQTLYREAEENLRQRFALLSLLAGKTPPATE
NT seq 3531 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccattgacggtaacagcgcagtggcgtccgtggcctatcgagccagcgaagtc
attgccatctatccgattacccccagctcaggcatggccgagcaggcctccgcctggtcc
gccgacggacgccccaacgtctggggcgatattccacgcgtcgtcgagatgcagtctgag
ggcggcgccatcgccgccgtacacggcgcgctgcagaccggggcactggccaccagcttt
acctcatcccaggggctgctgctgatgatccccaccttgtataagctggctggcgaatta
acccccttcgttctgcacgtcgccgcgcgcaccgtcgccacccatgcgctctccattttc
ggcgaccactccgacgtcatggcggtacgccagaccggctgcgctatgctgtgcgccgcc
agcgtgcaggaggcccaggatttcgccctgatagcccatatcgcctccctcaacagccgt
ctgccgtttatccacttcttcgacggtttccgcacctctcacgaaatcaacaaaatcgtg
ccgctggccgacgatacgctgcagacgctgctgccggcgcaggccatcgccgcccaccgc
acccatgcgctgaccccggagcacccggtgatccgcggaacctccgccaacccggacacc
tattttcaggcacgagaggccagcaacccgtggtacgacgccgcctatgaccacgtggcc
gacgccatgcaggccttcgccgaccagtgcgggcgccgctaccagccgtttgaatacgat
ggcgatcccgaggccacccgggtcatcgtcgtgatgggctccgcctgcggcacctgcgcc
gaggtgtgcgatatgctgcgcgcgcgcggggagaaggtgggcgtactgaaggtgcggctg
taccgtcccttctccgcccgtcacctgctcgccgcgctgcccctctccgcgcagcgcatc
gcggtgctcgaccgcaccaaagagccgggggcgctgggcgagccgctgtacctggacgtc
atcgccgcgctggcgcaggcggttagcagcggcgaacgcgccgcgctgccgctcaccatc
ggcgggcgctacggcctttccagcaaggagtttggccccgactgcgccctggcggtattt
gaggcgctggagaccccgcggcctcgaccgcgttttaccgtgggcatcaacgacgacgtg
acccacctctccctgccgcgccggacggatgtccacccggtgagcaaccggctggaggcg
ctgttctatgggctgggcagcgacggcaccgtctcggcggcgaagaacaacatcaagatt
atcggtaacagcacgccgctgcatgcccagggctactttgtctatgactccaaaaaagcc
ggcggcctgaccgtgtcacacctgcgagtacgggaaacgcccattcactccgcctacctg
gtggagcaggccgactttatcggctgccaccagtggcagttcattgaacgctatcagatg
gttgagcgtctgcgcctcggggggatcttcctactaaataccccctatgccgcagacgag
gcgtgggcgcggctgccccaggaggtgcaggcgctgctcaacgcacggcaggcgaagttc
tacgttctcaacgccgcccgtatcgcccgcgagtgtcggctcggcgcccgcatcaacacc
gtcatgcagatggccttcctgcacctcagcgacctgatccccaacggcggcgccctgccg
ctgctgcaggatgccatcgcccgcagctatgccaataaaggacaggagatcgtcgaacgc
aactggcaggcgctgggggcggtcgagggcgcgctgcacgccgttcccctgcgcccggtc
gatgccgagagcccgcgccggccgccgatcgtcgccgaccaggcgccggactttgtcaaa
accgttaccgccgccatgctggccgggctgggcgacagcctgccggtctccgccttcccg
ccggacggcacctggcccgtcggcactacccgctgggagaagcgtaatatcgccgaggcc
atccccatctggcagcccgccctctgcacccagtgtaaccactgcgtcgccgcctgcccc
cacgcggcgatccgcgccaaggtggtcgcgccggcggcgctggagcacgcgccagccacg
ctggagagcctggaggtccgcgcccgcgatctgcgcggcgagcgctatgtgctgcaggtg
gcaccggaagactgcaccggctgcaacctgtgcgtgacggtctgcccggcggcggatcgt
caggaccccagcgtcaaggccatcaatatgcaaccacgtctggcgcacctggcgcgggaa
aaggcgcattacgacgcgtttctggccctgccggagatcgaccgccgtcgcctggagcgc
atcgatatacgcacctcgcagctgatttcgccgctgtttgaatactccggcgcctgctcc
ggctgcggtgaaaccccctatatcaagctgctgacccagctgttcggcgatcgtatgctg
atcgcgaacgccaccggctgctcctccatctatggcggcaacctccccaccagcccctat
accaccgatgcacagggacgggggccggcctgggccaactcgctgtttgaggataacgcc
gagtttggcctcggcttccgcctgagcgcccagcagcaccgccagcgggcgctgcgcctg
ctccatgcgctggccggacagctgccggaggcgctggtcgcggcgctgcagcaggaggag
acgcccaccgagacgcggcgtcagcagatagcggcgctgcgcgcggccctggcgacgctc
gacgatccgcaggcccaggcgctggcgcagacggccgatgccctggtagagcaatccatc
tggctgatcggcggcgatggctgggcctacgatatcggcttcggcgggctggatcacgtg
ctgagcctgagcgaaaacgtcaacgtcctggtcctggatacccagtgctactccaatacc
ggcggacagcagtccaaggcgacgccgctggcagcggtcaccaagtttggcgaacacggt
aagcgcaaagcgcgtaaggatctcggcgtcagcataatgatgtatggccacgtctacgtc
gcccaaatctcgctgggcgctcagctgaaccagaccgtcaaggcgctgcaggaggccgaa
tcctacccgggcccctcgctggtgatcgcctacagcccctgtgaggagcacggctacgat
ctggccgacagccatgagcagatgaagcgcctgacggccaatggattctggccgctgtac
cgcgttgatccgcgccgcggcgccgaggggcagaacgccctagcgctggactcccggccg
cccagcggcgatctggcgcaaacgctgctggccgaacagcggttccgtcggctaaacagc
ctggcgccgcaggaggcgcagacgctataccgcgaggcagaggagaacctgcgtcagcgt
ttcgccctgctcagcctgctggcggggaaaacgccccctgccaccgagtaa

KEGG   Edwardsiella piscicida C07-087: ETAC_12055Help
Entry
ETAC_12055        CDS       T02509                                 

Definition
(GenBank) Pyruvate-flavodoxin oxidoreductase
  KO
K03737  pyruvate-ferredoxin/flavodoxin oxidoreductase [EC:1.2.7.1 1.2.7.-]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00020  Citrate cycle (TCA cycle)
etc00620  Pyruvate metabolism
etc00650  Butanoate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_12055
   00020 Citrate cycle (TCA cycle)
    ETAC_12055
   00620 Pyruvate metabolism
    ETAC_12055
   00650 Butanoate metabolism
    ETAC_12055
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     ETAC_12055
    1.2.7.-  
     ETAC_12055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N POR EKR Fer4 TPP_enzyme_C PFOR_II Fer4_16 Fer4_7 Fer4_6 Fer4_21 Fer4_10 Fer4_2 Fer4_9 Fer4_8 Fer4_17 Fer4_3 Fer4_4 Fer4_15 MHB Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AGH74532
Position
2717015..2720596
Genome map
AA seq 1193 aa AA seqDB search
MSQPDNDVMVDGNEAAAWVAYKLSEVCAIYPITPSSTMAELADEWASRHITNLWGNVPAI
MEMQHEGGAAGTVHGALQAGALSTTFTSSQGLMLMLPNMYKIAGELTSAVFHVASRSLAT
QGLSIFGDHQDVMAARSTGFAMLSSASVQQAQDLALIAHAATLESRIPFVHFFDGFRTSH
EVNKIHTLSEDDLREMIDDELVLAHRARALNPDRPVMRGTAQNPDTYFQGRESVNAYYQR
VPGIVERHMARFAELTGRRYRLVEYDGPADARHVVVVMGSAAATLRQTAALLNRDGGSNG
VLALHLYRPFPSEAFLNALPAACQVVTVLDRTKEPGAQGEPLYQDVLATLVYGVQHGLRA
ALPRLSGGRYGLSSKEFTPAMARAVFEQQQAASARPFFTIGIHDDVSGLSLPWDADWKPE
PDDQIRALFFGLGADGTVGANKNSIKIIGGLPDFYAQGYFVYDSRKSGSRTTSHLRFGPR
PIDSPYLIGSANFIGCHQFNFVHTLDMLEHARPGATFLLNSPYPAEAVWSHLPAAMQRQI
RAKALAFYVIDAAAVAQEVGMGSRINTIMQTCFFALSGVMDKEKAIALIKSSIRKTYGKK
GEEVVQKNFLAVDKTLEHLHAVTPPATDTLSEEQGWHLPTTAPRFVREVTAPMLLDRGER
IPVSLLPADGTYPTGTTRFEKRNIALEIPAWRPDLCIQCGNCAFVCPHAAIRAKFYHQDL
LDGAPQDFRSAPISARGFPETRYTLQVYPEDCTGCGLCVEACPVRHTEAGQPTPQRAISM
QDKLPLLEAEKRALAWFEHLPWPNRARVDFSNVRGVQFLEPLFEFSGACSGCGETPYLKT
LTQLFGDRMMVANATGCSSIYGGNLPTTPWSHNAEGRGPAWSNSLFEDNAEFGLGFRLAA
DKHLAMAQSQLQALAPQIGADLVAEILQAPQQQESQICAQRARLQQVRDRLSRLRGAQID
SLLSLLDHLVRRSVWIIGGDGWAYDIGSSGLDHVLASGRDVNVLVMDTEVYSNTGGQMSK
STPLGAVAKFAAGGKTMAKKDIALQAIAYGDVYVARIAFGANPQQTLEVLREAEAYPGPS
LIIAYSHCIAHGIDMRQGLMQQKRAVYAGHWPLIRYNPVLRERHVNPFLLDSLRPSLPLL
EYRQHETRYQALMRAHPQEAQRMMAIAQQVVDLKWAEYEAMARRDERAFPDTH
NT seq 3582 nt NT seq  +upstreamnt  +downstreamnt
atgagccagccggataatgatgtcatggtcgacggtaatgaggccgccgcctgggtcgcc
tataaactgagcgaggtctgcgcgatttaccccatcacccccagctctaccatggcggag
ctggcggacgagtgggccagccgccatatcaccaacctgtggggcaacgttcccgccatt
atggagatgcagcatgaggggggcgccgccgggacggtgcacggtgccctgcaggcgggc
gccctgagcaccaccttcacctcgtcgcaggggctgatgctgatgctgcccaatatgtat
aaaatcgccggcgagctgaccagcgcggtgttccacgtcgcctcccgctccctggctacc
caggggctgtcgatctttggcgaccaccaggacgtgatggcggcccgcagcaccggcttt
gccatgctgagcagcgcctcggttcagcaggcgcaggatctggcgctgatcgcccacgcg
gcgaccctggagtcacgcatcccctttgtccacttcttcgacggtttccgtacctcgcac
gaggtcaacaaaatccatacgctgagcgaagacgatctgcgcgagatgatcgatgacgag
ctggtgttggcccaccgcgcacgcgcgctgaatccggaccgcccggtgatgcgcggcacc
gcgcagaacccggatacctatttccaggggcgcgagagcgtcaacgcctactaccagcgc
gtaccgggtatcgtcgagcgccatatggcccgctttgccgagctgaccgggcgtcgctat
cgcctggtggagtacgacggtccggccgacgcccgccacgtggtggtggtgatgggctcc
gccgccgccaccctgcgtcagactgccgccctgctcaaccgggacggcggcagcaatggc
gtgctggcgctgcacctctaccgccccttccccagcgaggcctttctaaatgcgttgccc
gccgcctgccaggtggtcacggtgctcgatcgcaccaaagagccgggcgcgcagggggag
ccgctgtatcaggatgtgctggcgaccctggtctatggggtgcagcacggcctgcgcgcc
gcgctgccgcgcctgagcggcgggcgctacggtctctcctccaaagagtttaccccggcg
atggcgcgcgccgtattcgaacagcagcaggccgccagcgcgcgtccgttctttaccatc
ggcatccacgacgacgtcagcgggctgagcctcccctgggacgccgactggaagcccgaa
cctgacgatcagatccgcgccctgttcttcggcctcggcgccgacggcaccgtcggcgcc
aacaagaacagcattaagattatcggcgggctgcccgacttctacgcccagggctatttc
gtctatgactcgcgcaagtcgggatcgcgcaccacctcgcacctgcgctttgggccacgc
cccatcgactccccctacctgatcggcagcgccaactttatcggctgccaccagttcaac
tttgtccacacgctggatatgctggagcacgcgcgccccggcgccaccttcctgctcaac
agcccctacccggccgaggcggtctggtcccatctgccggcggcgatgcagcggcagatc
cgcgcaaaagccctggcgttttatgtcatcgacgccgccgcggtcgcgcaggaggtcggc
atgggcagccgcatcaataccatcatgcagacctgcttttttgccctctccggcgtgatg
gacaaggagaaggcgatcgcgctcatcaagagcagcatccgcaagacctacgggaagaag
ggagaggaggtggtgcagaagaactttctggccgtcgataaaaccctggagcatctgcat
gcggtgacgccgccggcgacggacaccctctcggaggagcagggctggcacctgccgaca
acggcgccgcgcttcgtacgcgaggtcaccgcgccgatgctgctcgaccgcggcgaacgg
attccggtctcgctgctgccggccgacggcacctatcccaccggcaccacccgctttgaa
aaacgcaatatcgccctggagatccccgcctggcgcccggatctgtgcatccagtgcggc
aactgcgcctttgtctgcccccatgccgccatccgcgccaagttttaccatcaggatctg
ctcgacggcgcgccgcaggatttccgctctgcgccgatcagcgcgcgcggtttcccggag
acccgctataccctgcaggtctacccggaggactgcaccggctgtgggctgtgcgttgag
gcctgtccggtgcgtcatacggaggcgggtcagcccaccccgcagcgcgccatcagcatg
caggacaagctgccgctgctcgaggccgaaaagcgggcgctggcgtggtttgagcacctg
ccgtggccgaatcgggcgcgggtcgacttctccaacgtgcgcggcgtacagttccttgag
ccgctgtttgagttctccggcgcctgcagcggctgcggcgagacgccgtacctgaagacc
ctcacccagctgttcggcgaccggatgatggtggctaacgccaccggctgctcctctatc
tacggcggcaacctgccgaccaccccctggagccacaacgccgaagggcggggcccggcc
tggtccaactcactgtttgaggacaacgccgaattcggcctgggcttccgcctggccgcc
gataaacacctggcgatggcgcagagccagctacaggcgctggcgccccagatcggcgcc
gatctggtcgccgagatcctgcaggctccgcagcagcaggaaagtcagatctgcgcccag
cgcgcccgtctgcagcaggtgcgcgatcgcctgagccgcctgcgcggcgcgcagatcgat
agcctgctgagcctgctggatcacctggtgcgtcggtcggtgtggatcatcggcggcgac
ggctgggcctacgatatcggctcctccgggctggaccacgtgctggcctccgggcgcgat
gtgaacgtactggtcatggataccgaggtctactccaacaccggcgggcagatgtccaag
tcgaccccgctgggcgccgtggccaagtttgccgccggcggcaagacgatggcgaagaag
gatatcgccctgcaggccatcgcctacggcgatgtctacgtggcccgcatcgcctttggc
gccaacccgcagcaaacgctggaggtactgcgcgaggccgaggcctatccggggccgtcg
ctgatcatcgcctacagccactgtatcgcccacggcatcgatatgcgccaggggctgatg
cagcagaagcgggcggtctacgccggccactggccgctgatccgctataacccggtgctg
cgggagcggcatgtcaatccgttcctcctcgacagcctgcgtccatcgctgccgctgctg
gaataccgtcagcatgaaacccgctaccaggcgctgatgcgcgcccacccgcaggaggcg
cagcgcatgatggcgattgcccagcaggtggtcgatctgaagtgggcggagtacgaggcg
atggcgcgccgcgacgagcgcgccttcccggatacgcactga

DBGET integrated database retrieval system