KEGG   Edwardsiella piscicida C07-087: ETAC_08210Help
Entry
ETAC_08210        CDS       T02509                                 

Definition
(GenBank) phosphoenolpyruvate synthase
  KO
K01007  pyruvate, water dikinase [EC:2.7.9.2]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00620  Pyruvate metabolism
etc00680  Methane metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ETAC_08210
  09102 Energy metabolism
   00680 Methane metabolism
    ETAC_08210
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.2  pyruvate, water dikinase
     ETAC_08210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PPDK_N PEP-utilizers_C PEP-utilizers HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AGH73763
Position
complement(1870512..1872887)
Genome map
AA seq 791 aa AA seqDB search
MSSNGAQLQNVVWYNQLGMHDVERVGGKNASLGEMITNLSELGVSVPNGFATTAQAFNDF
LDQSGVNQRIYALLDQTNIDDVDALARAGAQIRRWVIETPFPAALEAEIRSAYATLAADN
ANASFAVRSSATAEDMPDASFAGQQETFLNVQGIDAVMTAVKHVFASLFNDRAISYRVHQ
GYDHRGVALSAGVQLMVRSDLAASGVMFTLDTESGFDQVVFITSAYGLGEMVVQGAVNPD
EFYVHKPTLQAGRPAIVRRTLGSKKIRMVYADSQEHGKQVRIEDVPAAQSGRFSLSDEEI
QQLARQALLIEQHYGRPMDIEWAKDGHSGTLYIVQARPETVRANEQVMERYHLSQRGEVL
VEGRAIGHRIGAGPVKVITSISEMHLIQAGDVLVTDMTDPDWEPIMKRAAAIVTNRGGRT
CHAAIIARELGIPAVVGCGDATERLRPGTAVTVSCAEGDTGYVYRGQIDFSVQSSQVEQM
PALPLKIMMNVGNPDRAFDFARLPNDGVGLARLEFIINRMIGVHPRAALEFDRQDAAVQA
EIRQMMQGFDDPVEFYVSRLTEGIATLAAAFWPKRVIVRLSDFKSNEYANLIGGERYEPH
EENPMLGFRGAGRYVAESFAPCFALECDAIKRVRNTMGLTNVEVMIPFVRTVEQAQAVVS
QLAKEGLRRGENGLKVIMMCEIPSNALLADDFLAHFDGFSIGSNDMTQLTLGLDRDSGVV
SALFDERNAAVKALLSMAIRSAKAQGKYVGICGQGPSDHEDFARWLMEQGIDSLSLNPDT
VVQTWINLAEK
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtaatggcgcgcaattacagaatgtggtgtggtacaaccagctcgggatgcac
gatgtcgagcgggtcggcggtaaaaatgcctctctgggcgagatgataaccaacctgtct
gagctgggcgtgtcggtgccgaatggctttgccaccacggcgcaggcgtttaatgatttt
ctggatcagagcggcgtcaaccagcggatctatgcgctgttggatcagacgaacatcgat
gacgtcgacgcactggcgcgggcgggagcgcagattcgccgctgggtgatcgaaaccccg
ttcccggcggcgctggaggcggagatccgcagcgcctatgccaccttggccgcggacaac
gccaacgcctccttcgccgtgcgctcctcggcgacggcggaggatatgcccgatgcctcg
tttgccgggcagcaggagacctttctcaacgtacagggcatcgatgcggtgatgacggcg
gtgaagcatgtcttcgcctcgctgtttaacgatcgcgccatttcctaccgagtgcatcag
ggctatgaccaccgcggcgtagcgctctctgccggggtccaactgatggtgcgctccgat
ctggcggcctctggggtgatgtttaccctggataccgagtcggggttcgatcaggtggtc
tttatcacctcggcctatgggctgggcgaaatggtggtgcagggggcggtaaaccccgat
gagttttacgtgcataagccgaccctgcaggcggggcggccggctatcgtgcgccgcacg
ctggggtcgaagaagatccgcatggtgtatgccgacagccaggagcacggaaagcaggtg
cgcattgaggatgtccccgcggcgcagagcgggcgctttagcctgagcgacgaggagatc
cagcagctggcgcgccaggcgctgctgatcgagcagcactatggccgtccgatggacatc
gaatgggccaaggatggacacagcggcacgctgtacatcgttcaggctcgtccggagacc
gtgcgggccaacgagcaggtgatggagcgctaccacctgagccagcgcggcgaagtgctg
gtggaggggcgcgccatcggccatcgtatcggcgccgggccggtgaaggtgatcaccagc
atcagcgagatgcacctgatccaggcgggcgatgtgctggtgacggacatgaccgacccg
gactgggagccgatcatgaagcgggccgcggcgatagtaaccaaccgcggcgggcgcacc
tgccatgcggcgatcatcgcgcgcgagctggggatcccggcggtcgtcggctgcggcgat
gccaccgagcgcctgcggccggggacggcggtgacggtctcctgcgccgaaggggatacc
ggctacgtttaccgcgggcagatcgacttcagcgtgcagagttcgcaggtcgagcagatg
ccggcgcttcccctgaagatcatgatgaacgtcggcaatccggatcgcgcctttgacttc
gcccgtctgcccaacgacggcgtggggctggcgcggctggaatttatcattaaccggatg
atcggcgtgcatccgcgcgcggcgctggagttcgatcgtcaggatgcggcggtgcaggca
gagatccgtcagatgatgcaggggtttgacgatccggtggaattctacgttagccgtctg
accgagggcatcgcgacgctggcagcggcattctggcccaagcgggtgatcgtccgcctg
tcagactttaagtccaatgaatatgccaacctgatcggcggtgagcgctatgaaccccat
gaggagaacccgatgctggggttccgcggtgccggtcgctatgtggcggagagctttgcc
ccctgcttcgccctggagtgtgacgccattaagcgggtgcgcaatacgatggggctgacc
aacgtcgaggtgatgattccctttgtgcgcacggtggagcaggcgcaggcggtggtctct
cagctggcgaaagaggggctgcgccgcggtgaaaacggcctgaaggtgatcatgatgtgc
gagatcccctccaatgcgctgctggccgacgacttcctggcccatttcgacggtttctcc
atcggctctaacgatatgacgcagcttaccctggggctggatcgcgactccggggtggtc
tctgcgctgtttgacgagcgcaacgcggcggtgaaggcgctgctgtcgatggctatccgt
agcgctaaggcgcaggggaaatacgtagggatctgcggtcagggcccctcggatcatgag
gactttgcccgctggttaatggagcagggaattgacagcctgtcgctgaatccggatacg
gtggtgcagacctggattaatctggcagaaaaataa

DBGET integrated database retrieval system