KEGG   Edwardsiella piscicida C07-087: ETAC_08295Help
Entry
ETAC_08295        CDS       T02509                                 

Definition
(GenBank) Vitamin B12 ABC transporter, ATPase component BtuD
  KO
K06074  vitamin B12 transport system ATP-binding protein [EC:7.6.2.8]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00241  Vitamin B12 transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_08295
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_08295
Enzymes [BR:etc01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.8  ABC-type vitamin B12 transporter
     ETAC_08295
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Vitamin B12 transporter [MD:M00241]
    ETAC_08295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_25 AAA_16 SMC_N SbcCD_C AAA_29 AAA_30 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AGH73780
Position
complement(1888449..1889216)
Genome map
AA seq 255 aa AA seqDB search
MGGSLLRIAGLTVPGRLDAVDASVARGALVHVIGPNGAGKSSLLLRLAGLVSGEGEVWLA
GQSLLRQSPTAQARRRACLVQQQMPNALMPVFAYLALHAPRHADAAALDGALASLSGRLG
LSDKLSRPLSHLSGGEWQRVRLAAVLLQIWPTVNPEGRLLLLDEPMSSLDIRQQAALDSL
LGELCAAGITVIASAHDLNHTLYHADTVWMLSQGQMIAQGDARAVMQVETLSRLFDVPFR
RIHGGDRDWLYYQNG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtagtctgctgcgcatcgccgggctgacggtgccggggcggctggacgctgtt
gatgccagcgtcgcccgcggggcgctggtgcacgtgattggccccaacggcgcggggaaa
agttcgctgttgctgcggctggccggcttagtgagcggagagggcgaggtgtggctggcg
gggcagtcgctgctgcggcagtcgcccacggcgcaggcgcggcggcgcgcctgtctagtg
cagcagcagatgccgaacgccctgatgccggtgtttgcctacctggcgctgcacgcgccg
cgccacgcggacgccgcggcgctggacggcgcactggcgtcgctcagtgggcgcctaggc
ctcagcgataagctgagccgtccgctgagccatttgtccggcggcgagtggcagcgggtg
cgactggcggcggtgctgctgcagatctggccgaccgtaaacccggaagggcgcctgctg
ctgctggatgagccgatgagcagcctggatatccgccagcaggccgcattggacagcctg
ctcggtgagctgtgcgcggccgggatcacggtgatcgccagcgcgcacgatctcaaccac
acgctgtaccatgccgatacggtgtggatgctcagccaggggcagatgatagcgcaggga
gacgcgcgggcggtgatgcaggtggagacgctgagccggctgtttgacgttccctttcgc
cgcattcacgggggcgatcgcgactggctctattatcaaaatggctaa

DBGET integrated database retrieval system