KEGG   Edwardsiella piscicida C07-087: ETAC_08365Help
Entry
ETAC_08365        CDS       T02509                                 

Definition
(GenBank) 6-phosphofructokinase 2
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00030  Pentose phosphate pathway
etc00051  Fructose and mannose metabolism
etc00052  Galactose metabolism
etc00680  Methane metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_08365
   00030 Pentose phosphate pathway
    ETAC_08365
   00051 Fructose and mannose metabolism
    ETAC_08365
   00052 Galactose metabolism
    ETAC_08365
  09102 Energy metabolism
   00680 Methane metabolism
    ETAC_08365
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ETAC_08365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Sulf_coat_C
Motif
Other DBs
NCBI-ProteinID: AGH73794
Position
complement(1903083..1904036)
Genome map
AA seq 317 aa AA seqDB search
MNPIYTLTLSPSLDCSTSTAKIYPEGKLRCSQAIYQPGGGGINVARAIQRMGGGAVAIYP
AGGSTGAHLTTLLLAEGVAVDTIEAQAWTRQNMHVSATATGEQFRFVMPGAALTPREFDL
LAQRLDQIPTDALLVVSGSLPENITPSRFSALLQHIRQRGIRCVVDTSGDALMAAVNQGG
LTLIKPNQKELATLSGRDMTQPASVLQAAHALVLQGAAQYVVVSLGAQGAIAVDRQAWIQ
VTPPPIKALTTVGAGDSMVAAMTLQLAQGGSLSALAIGGVAAGTAATLRHGTELCQASDV
AEIVAYIEAHHPQPHSF
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctatctatacccttacgctgtctccctcgctggactgttcgaccagcacggcc
aaaatatatcctgagggtaagctacgctgcagtcaggccatctaccaaccgggcggcggt
gggatcaacgtggcccgggccattcagcgcatgggcggcggtgccgtggccatctatccg
gcgggaggatcgaccggcgcgcacttgaccacgctgctgctggcggagggggtggcggtc
gatacgatcgaggcgcaggcctggacgcgtcagaatatgcatgtcagtgcgacggcgacc
ggcgagcagttccgttttgtgatgcccggcgcggcgctgacgccgcgggagttcgatctc
ctggcgcaacgattggatcagatccccaccgatgccctcttggtggtgagtgggagtctg
ccggagaacattacgccgtcgcggttttccgcgctgctgcagcacattcgtcagcgcggt
attcgctgcgtcgtcgatacctcgggcgatgccctgatggcggcggtgaatcaaggggga
ctgacgctgattaagcccaatcaaaaggagctggcgacgttgagcggtcgagatatgacc
cagccggcctcggttttgcaggcggcccacgcgctggtattacagggcgccgcacagtat
gtggtggtttcgctgggggcgcagggagcgattgccgtcgatcgccaggcctggattcag
gtgacgccgccgccgattaaggcactgacgacggtgggggccggcgacagtatggtcgcc
gcgatgacgctgcagctggctcagggaggatcgctgagcgcgctggcgatcggcggcgtt
gcggccggaaccgcggcgacgctgcgccatggcaccgaactctgccaggcgagcgatgtc
gccgagatcgtggcttatatcgaggcccaccacccacagccgcattcattttaa

KEGG   Edwardsiella piscicida C07-087: ETAC_16370Help
Entry
ETAC_16370        CDS       T02509                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00030  Pentose phosphate pathway
etc00051  Fructose and mannose metabolism
etc00052  Galactose metabolism
etc00680  Methane metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
etc03018  RNA degradation
Module
etc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_16370
   00030 Pentose phosphate pathway
    ETAC_16370
   00051 Fructose and mannose metabolism
    ETAC_16370
   00052 Galactose metabolism
    ETAC_16370
  09102 Energy metabolism
   00680 Methane metabolism
    ETAC_16370
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    ETAC_16370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:etc01009]
    ETAC_16370
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:etc03019]
    ETAC_16370
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ETAC_16370
Protein phosphatases and associated proteins [BR:etc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ETAC_16370
Messenger RNA biogenesis [BR:etc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ETAC_16370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AGH75395
Position
complement(3705764..3706726)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALSKGLDVYGIHDGYLGLYEGRIEQLDRYSVSD
VINRGGTFLGSARFPEFRDEKVREKAVENMREFGLDALVVIGGDGSYLGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEYIVLPEVEFKREELVEEIKAGITKGKKHAIVAITEHICDVDELAKFIEQETG
RETRSTVLGHIQRGGAPVAYDRILASRMGAYSIELLLQGYGGRCVGIQNEKLVHHDIIDA
VENMKRPFKGDWLDTAKILF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaaatcggtgttttgaccagtggcggtgacgcgccgggcatgaacgcggcc
atccgcggcgtcgtgcgtgcggccttgtccaaagggttagacgtttacggcatccatgat
ggctacctcggtctgtatgaaggacgcattgagcaactggaccgctacagcgtctccgac
gtgatcaaccgcggcggtactttccttggctcagcccgtttcccggagtttcgcgacgag
aaagtgcgtgaaaaggccgtagagaacatgcgtgagtttggcctggatgcgctggtggtg
atcggcggtgacggttcctatttgggcgctaagcgcttgactgagatggggttcccctgc
attggcctgccgggaactatcgataacgatgtggccggcaccgattacaccatcgggtat
tttacggcgctggaaaccgttgtagaggccattgaccgtctgcgcgatacctcctcttca
caccagcgtatctccatcgtcgaggtgatggggcgttactgtggcgacctgacgctggcg
gcggcgatcgccggcggctgcgaatatatcgtgctgccggaggtggagttcaagcgcgaa
gagctggtcgaagagattaaggccggcatcactaaaggcaagaaacacgctatcgttgcc
atcaccgagcatatctgtgatgtggatgagctggccaagtttatcgagcaggagaccggt
cgtgaaactcgctcgaccgtactgggacatatccagcgcggcggtgcgccggtggcctat
gaccgcatcctcgcgtcgcgcatgggcgcctactccattgagctgctgctgcagggatac
ggcggccgctgcgtggggatccagaacgaaaagctggtgcaccacgacatcatcgatgcg
gttgaaaatatgaagcgtccgtttaagggcgattggctggatacggccaagatactgttc
taa

DBGET integrated database retrieval system