KEGG   Edwardsiella piscicida C07-087: ETAC_08550Help
Entry
ETAC_08550        CDS       T02509                                 

Definition
(GenBank) antimicrobial peptide ABC transporter periplasmic binding protein SapA
  KO
K19226  cationic peptide transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc01503  Cationic antimicrobial peptide (CAMP) resistance
etc02010  ABC transporters
Module
etc_M00739  Cationic peptide transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_08550
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ETAC_08550
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_08550
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Cationic peptide transporter [MD:M00739]
    ETAC_08550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: AGH73831
Position
1945205..1946884
Genome map
AA seq 559 aa AA seqDB search
MRALKTLFIPLLLLSAAATAAEKPAPQPAPAVPDIRQSGFIYCVNGIVNTFNPQMASSGV
TVDTLAAQLYDRLLDVDPYTYRLIPELAQSWEVLDGGATYILHLRRDVPFQKTAWFTPTR
NMNADDVLFSFERMFDPKHPYHDVNGGHYPYFDSLQFSNAVQSIRRLDDYSVEIRLKQPD
ASFLWHLATHYAPVLSAQYADALAKRGHQAQIDRLPVGTGPFMLDEYRAGQFIRLARNPQ
YWKGTPRMAQVVIDLGAGGTGRISKLLTGECDVLAYPAASQLGILRDDPRLRLTLRPGMN
VAYLAFNTRKPPLDNVDVRRAIAYSINNQRLMQSIYYGTAETAASLLPRASWAYDNDARV
TDYNPEKARAMLKAAGISNLRLQLWVPTASQAYNPSPLKTAELIQADMAQVGIKVTIVPV
EGRFQEARLNDMSHDMTLSGWATDSNDPDSFFRPLLSCAAIQSQTNLAHWCDPAFDTLLH
QALQSQQLSQRIDDYQAAQKILEQQLPILPLASSLRLQAYRHDIKGLVLSPFGNASFAGV
YREMPPPAPVPAPPDKEKP
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctctgaaaacactgtttattccgctgctgctcctgtcggcagcggccacggcg
gccgagaaaccggcgccgcagcccgcccccgctgtgccggatatccgccagagcgggttt
atctattgcgtcaacgggatcgtcaatacgttcaacccacagatggccagcagcggcgta
acggtggataccctggcggcccagctctacgaccggctgctggatgtcgacccctatacc
tatcggctgatccccgagctggcgcaaagctgggaggtgctcgacggcggcgcgacctat
attctgcatctgcgccgcgatgtgccgttccagaaaaccgcctggtttaccccgacccgc
aacatgaacgccgacgatgtgctgttcagcttcgagcgcatgttcgaccccaagcacccc
tatcacgacgtcaacggcggtcactacccctacttcgatagtctgcagttcagcaatgcg
gtgcagagcatccgccggctggacgattacagcgtcgagatccgcctgaagcagcctgac
gcctctttcctctggcacctggcgacccactatgcgccggtgctctcggcccagtacgcc
gatgcgctggccaagcgcggccaccaggcgcagatagaccggctgccggtcggcaccggc
ccctttatgctggatgagtatcgcgccgggcagtttatccgcctggcgcgtaaccctcag
tactggaaaggaacgccgcgcatggcgcaggtggtcatcgacctgggcgccggcggcacc
ggacggatctccaagctgctaaccggcgagtgcgatgtgctggcctaccccgcggccagc
cagctgggcatcctgcgcgacgatccgcgcctgcgcctcaccctgcgcccggggatgaac
gtcgcctatctggcgtttaacacccgcaagccgccgctggacaacgtcgacgtccgccgc
gccatcgcctattcgatcaataaccagcgtctgatgcagtcgatttactatggcacggcg
gagacggcggcctccctgctgccgcgcgcctcctgggcctacgacaacgacgcgcgcgtt
accgactacaacccggagaaagcgcgcgccatgctcaaggccgccgggatcagcaacctg
cgcctgcagctgtgggtgccgaccgcctcccaggcctataaccccagcccgctgaaaacc
gccgagctgatccaggccgatatggcccaggtcgggatcaaggtcaccattgtgccggta
gaggggcgctttcaggaggcccggctgaacgatatgagccatgatatgaccctgtccggc
tgggcgaccgacagcaacgatccggacagcttcttccgtccgctgctcagctgcgccgcc
attcagtcccagaccaacctggcccactggtgcgatccggcgttcgataccctcctgcac
caggcgctgcagtcccagcagctctcccagcggattgacgactatcaggcggcgcaaaaa
atcctggagcagcagctgccgatcctgccgctggcctcctcgctgcgcctgcaggcctat
cgccatgacatcaaaggactggtgctcagcccgttcggcaacgcctcgttcgccggggtc
tatcgcgaaatgccgcccccggcgcccgtgcctgcgccgccggacaaggagaaaccatga

DBGET integrated database retrieval system