KEGG   Edwardsiella piscicida C07-087: ETAC_08565Help
Entry
ETAC_08565        CDS       T02509                                 

Definition
(GenBank) antimicrobial peptide ABC transporter ATP-binding protein
  KO
K19229  cationic peptide transport system ATP-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc01503  Cationic antimicrobial peptide (CAMP) resistance
etc02010  ABC transporters
Module
etc_M00739  Cationic peptide transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_08565
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ETAC_08565
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_08565
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Cationic peptide transporter [MD:M00739]
    ETAC_08565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA AAA_5 AAA_16 Sigma54_activat AAA_29
Motif
Other DBs
NCBI-ProteinID: AGH73834
Position
1948723..1949718
Genome map
AA seq 331 aa AA seqDB search
MPLLDIRNLTIEFMTPEGPVKAVDRVSLTLSEGEIRGLVGESGSGKSLIAKAICGVTKDN
WRVTADRMRFDDIDLLRLSPRQRRRLVGHNVSMIFQEPQSCLDPSERIGRQLIQAIPGWT
YKGRWWQRFRWRRRRAIELLHRVGIKDHRDAMRSLPYELTEGECQKVMIAIALANQPRLL
IADEPTNAMEPTTQAQIFRLLARMNQNNNTTILLISHDLQMMSKWADRINVMYCGQTVES
ASCEEILSAPHHPYTQALIRAMPDFGRALPPKSRLNTLPGAIPSLEHLPIGCRLGPRCPY
AQKKCIQTPTLRSVKNHSFACHFPLNTEEAQ
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgccgctactcgatatccgcaacctgaccattgagttcatgaccccggagggcccggtc
aaggccgtcgaccgcgtcagcctgaccctcagcgaaggtgaaatccgcggcctggtcggt
gagtctggctcaggtaagagcctgatcgccaaagccatctgtggggtgaccaaggacaac
tggcgggtgaccgccgaccgtatgcgctttgacgacatcgacctgctgcgcctgtcgccg
cgtcagcgacgccgcctggtcggccataacgtctcgatgatcttccaggagccgcagtcc
tgtctcgacccctccgaacgcattggccgccagctgatccaggcgatccccggctggacc
tataaaggccgctggtggcagcgctttcgctggcgtcgtcgccgcgccattgagctgctg
caccgcgtcggcatcaaagatcaccgcgatgccatgcgcagcctgccctacgagctgacc
gagggcgagtgtcagaaggtgatgatcgccatcgcgctggccaaccagccgcgtctgctg
atcgccgatgagccgaccaacgccatggagccgaccacccaggcgcagatcttccgcctg
ctggcgcgcatgaaccagaacaacaacaccaccattctgctgatcagccacgatctgcag
atgatgagtaagtgggccgaccgcattaacgtcatgtactgcgggcagacggtggagagc
gccagctgtgaagagatcctcagcgcgccgcaccacccctatacccaggcgttgatccgc
gcaatgcccgactttggccgggcgctgccgcccaagagccgcctgaacaccctgcccggc
gccataccgtcgctggagcatctgccgatcggctgccgcctggggccacgctgcccctac
gcccagaaaaagtgtattcagacccctaccctgcgcagcgtgaaaaaccacagttttgcc
tgccatttcccgctgaacacggaggaggcccagtga

DBGET integrated database retrieval system