KEGG   Edwardsiella piscicida C07-087: ETAC_08580Help
Entry
ETAC_08580        CDS       T02509                                 

Definition
(GenBank) trans-2-enoyl-CoA reductase
  KO
K00209  enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase (NAD+) [EC:1.3.1.9 1.3.1.44]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00061  Fatty acid biosynthesis
etc00650  Butanoate metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc01200  Carbon metabolism
etc01212  Fatty acid metabolism
Module
etc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ETAC_08580
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ETAC_08580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:etc01004]
    ETAC_08580
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     ETAC_08580
    1.3.1.44  trans-2-enoyl-CoA reductase (NAD+)
     ETAC_08580
Lipid biosynthesis proteins [BR:etc01004]
 Fatty acid synthase
  Component type
   ETAC_08580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enoyl_reductase Eno-Rase_NADH_b Eno-Rase_FAD_bd
Motif
Other DBs
NCBI-ProteinID: AGH73837
Position
complement(1951675..1952868)
Genome map
AA seq 397 aa AA seqDB search
MIIKPKVRGFICTTTHPVGCEANVRRQIAYTQAKGPIENGPKKVLVIGASTGYGLASRIA
AAFGAGAATIGVFFEKPGTETKTGSAGWYNAAAFDKAAKASGLYAKSVNGDAFSNECRQK
VIELIKQDLGQVDLVVYSLASPVRKLPDTGEVVRSALKPIGEVYTTTAIDTNKDQIISAS
VEPATEEEIQNTITVMGGQDWELWMSALRDAGVLADGAKSVAYSYIGTDLTWPIYWHGTL
GRAKEDLDRAAAGIRGDLAAHGGTAHVAVLKSVVTQASSAIPVMPLYISMSFKIMKEKGI
HEGCMEQVDRMMRTRLYGSDMALDDHARIRMDDWELRDDVQQACRDLWPSITSENLSQLT
DYSGYKQEFLRLFGFGLDGVDYDADVNPDVQFDVVTL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgattatcaaacccaaggttcgcggttttatctgcaccactacccatccggttggctgt
gaagccaacgtccgtcgtcagatcgcctacacccaggctaaaggaccgattgagaacggc
cctaaaaaggtgctggtgatcggtgcgtcgaccggctatggcctggcgtcgcggatcgcc
gcagcctttggcgccggcgccgccacgatcggcgtgttctttgagaagccgggtacggaa
accaagaccgggagcgccggctggtataacgccgccgcgtttgacaaggcggccaaagcg
tcgggcctctacgctaagagcgtcaacggcgatgcgttctccaacgaatgccgccagaag
gtgatcgagctgattaagcaggacctggggcaggtggatctggtggtctactcgctggcc
tcaccggtgcgcaagctgccggataccggcgaggtggttcgctcggcgctgaagcctatc
ggtgaggtgtataccaccaccgccatcgataccaacaaggatcagatcatctccgccagc
gtcgagccggcgacggaagaggagatccagaacaccatcaccgtcatgggtgggcaggac
tgggagctgtggatgtccgcgctgcgtgacgccggggtcctggccgacggcgccaagtcc
gtggcgtactcctacatcggtaccgacctgacctggcctatctactggcacggtacgctg
ggccgcgcgaaggaagatctggaccgcgccgcggcgggcattcgcggcgatctcgccgcc
cacggcggtacggcccacgtcgccgtgctgaagtcggtggtgacgcaggcctccagcgcg
attccggtgatgccgctgtacatctcgatgtccttcaagatcatgaaggagaagggcatc
cacgaaggctgcatggagcaggttgatcgtatgatgcgcacgcgtctgtacggtagcgac
atggcgctggacgatcacgcccgcatccgcatggatgactgggagctgcgtgacgacgta
cagcaggcctgccgcgatctgtggccgtccatcaccagcgagaacctcagccagctgacc
gactacagcggctacaagcaggagtttctgcgcctgttcggcttcggtctggacggggta
gactatgacgccgatgtgaatccggacgtgcagttcgacgtggttacgctgtaa

DBGET integrated database retrieval system