KEGG   Edwardsiella piscicida C07-087: ETAC_08605Help
Entry
ETAC_08605        CDS       T02509                                 

Gene name
potA
Definition
(GenBank) putrescine/spermidine ABC transporter ATPase protein
  KO
K11072  spermidine/putrescine transport system ATP-binding protein [EC:7.6.2.11]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00299  Spermidine/putrescine transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_08605 (potA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_08605 (potA)
Enzymes [BR:etc01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.11  ABC-type polyamine transporter
     ETAC_08605 (potA)
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Spermidine/putrescine transporter [MD:M00299]
    ETAC_08605 (potA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran TOBE_2 AAA_21 SMC_N TniB AAA_22 AAA Rad17 AAA_16 AAA_28 ABC_ATPase RsgA_GTPase PhoH AAA_18 AAA_23 NACHT ATPase_2 sCache_3_2 AAA_30 AAA_14 HSM3_N NB-ARC AAA_29
Motif
Other DBs
NCBI-ProteinID: AGH73842
Position
1959062..1960195
Genome map
AA seq 377 aa AA seqDB search
MTETSSVDAQALPVVCLTHIRKSFDGKAIIPDLDLSINHGEFVTILGPSGCGKTTVLRLI
AGLEEVDSGQVALDGEEITHQPAEQRHVNTVFQSYALFPHMSVFENVAFGLRMQKTPHHD
IAPRVMDALRMVQLDELAQRRPHQLSGGQQQRVAIARAVVNKPRVLLLDESLSALDYKLR
KQMQNELKALQRKLGITFIFVTHDQEEALTMSDRIIVMRDGRIEQDGSPREIYEEPKNLF
VASFIGEINIFDAEVLQRIDEQRVRANVEGRECDIYVNPALPVSQGDRLKVLLRPEDLRV
EEISDSEQVDGIIGYVRERNYKGMTLESSVELENGKMVMVSEFFNEDDPDVDHSLDQKVA
VTWVESWEVVLPDEEIA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgactgagacttcctctgtagacgcccaggcgctgccggtcgtatgcctgacccacatc
cgcaaatcctttgacggcaaagcgatcattcccgatctcgacctgagcattaatcacggt
gaatttgtcaccattcttggcccctccggctgcggtaaaaccacggtgctgcgtctgatc
gccgggctggaagaggtcgacagcggccaggtcgcgctggacggcgaggagataacccac
cagcccgccgaacagcgccacgtcaacaccgtcttccagagctacgccctgtttccgcac
atgagcgtctttgaaaacgtggcctttggcctgcgcatgcagaaaaccccgcaccatgac
atcgcgccgcgcgtcatggatgccctgcgcatggtacagctggacgagctggcccagcgc
cgcccgcatcagctctccggcggccagcagcagcgggtggccatcgcccgcgcggtggtc
aataagccacgggtactgctgctggacgagtcgctgtcggcgctggactacaagctgcgc
aagcagatgcagaacgagctgaaggcgctgcagcgcaagctgggcatcacctttatcttc
gtcacccacgatcaggaagaggcgctgaccatgtccgaccgcatcatcgtgatgcgcgat
ggacgtatcgaacaggatggctcgccgcgcgagatctacgaagaaccgaagaacctgttt
gtggccagctttatcggcgagatcaacatattcgatgccgaggtgctgcagcgtatcgat
gagcagcgggtgcgcgccaacgtcgaggggcgcgagtgcgatatctacgtcaacccggcg
ctgccggtcagccagggcgaccgcctcaaggtgctgctgcggccggaagatctgcgcgtg
gaggagatcagcgacagcgagcaggtcgacggcatcatcggctatgtgcgcgagcgcaac
tacaaagggatgaccctggagtccagcgtagagctggaaaacggcaagatggtgatggtc
agcgagttttttaacgaggacgatcccgacgtagaccattcgctcgatcagaaggtagcg
gtaacctgggtcgaaagctgggaggtggtgctgcctgatgaagaaatcgcgtaa

DBGET integrated database retrieval system