KEGG   Edwardsiella piscicida C07-087: ETAC_08610Help
Entry
ETAC_08610        CDS       T02509                                 

Gene name
potB
Definition
(GenBank) spermidine/putrescine ABC transporter membrane protein
  KO
K11071  spermidine/putrescine transport system permease protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00299  Spermidine/putrescine transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_08610 (potB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_08610 (potB)
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Spermidine/putrescine transporter [MD:M00299]
    ETAC_08610 (potB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Trep_Strep
Motif
Other DBs
NCBI-ProteinID: AGH73843
Position
1960179..1961045
Genome map
AA seq 288 aa AA seqDB search
MKKSRKLFQNVVIALVVGWLSLFVFLPNLMIIGTSFLTRDDANLVQMVFTGSNYARLFDP
LYAEVLLHSLNMALIATLCCLVIGYPFAFILARLPHRVRPLLLFLLIVPFWTNSLIRIYG
LKLFLSTRGYLNEFLLWIGIIDQPLRLMYTSTAVVLGLIYILLPFMVMPLYSSIEKLDRS
VLEAARDLGANRLQTFMRIIVPLTMPGIVAGCLLVLLPSLGMFYIADLLGGAKNLLIGNV
IKSQFLNIRDWPFGAATSICLTLVMGVMLLIYYRVGKLLNRKASDLAD
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatcgcgtaaactgtttcaaaatgtcgtgatcgcgctggtggtgggctggctg
tcgctgttcgtcttcctgccgaacctgatgatcatcggcaccagctttctgacccgcgat
gacgccaacctggtacagatggtgttcaccgggagcaactacgcccggctgttcgacccg
ctgtacgccgaggtgctgctgcactcgctcaacatggcgctgatcgccaccctgtgctgc
ctggtcatcggctatccctttgcctttattctggcccgcctgccccaccgggtgcgcccg
ctgctgctgtttttgctgatcgtcccgttctggaccaactcgctgatccggatctacggg
ctgaagctattcctcagcacccgcggctacctcaacgaattcctgctctggatcggcatc
atcgatcagccgctgcggctgatgtacacctccacggcggtggtgctggggctgatttac
attctgctgccctttatggtgatgccgctctactccagcattgaaaagctggatcgctcg
gtgctggaggcagcgcgcgacctaggcgccaatcggctacagaccttcatgcgcatcatc
gtaccgctgaccatgccggggatcgtcgccggctgcctgctggtgctgctgccgtcgctg
ggcatgttctacatcgccgacctgctgggcggcgccaaaaacctgctgatcggcaacgtc
atcaagagccagttcctcaatattcgcgactggccgtttggcgccgccaccagcatctgc
ctgacgctggtgatgggggtcatgctgctgatctactaccgggtcggtaagctactcaac
cgtaaggccagcgacttggcagactga

DBGET integrated database retrieval system