KEGG   Edwardsiella piscicida C07-087: ETAC_08625Help
Entry
ETAC_08625        CDS       T02509                                 

Gene name
potD
Definition
(GenBank) spermidine/putrescine ABC transporter periplasmic substrate-binding protein
  KO
K11069  spermidine/putrescine transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00299  Spermidine/putrescine transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_08625 (potD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_08625 (potD)
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Spermidine/putrescine transporter [MD:M00299]
    ETAC_08625 (potD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_8 SBP_bac_6 SBP_bac_1 SBP_bac_11 Lipoprotein_8
Motif
Other DBs
NCBI-ProteinID: AGH73846
Position
1963959..1964975
Genome map
AA seq 338 aa AA seqDB search
MGAHAAHAADAPKTDNNTVYFYNWTEYVPPGLLEQFTKETGIKVIYSTYESNETMYAKLK
TYREGAYDLVVPSTYYVAKMRNEGMLQKIDHDKLSNFHNLDPNLLHKSFDPKNDYSIPYI
WGATAIGVNSDAIDPASVTSWADLWKPEYKGSLLLTDDAREVFQVALRKLGYSGNTTDPK
QIQAAYQALVKLMPNVLAFNSDNPANPFMEGEVNLGMIWNGSAYVARQAGTPVQIVWPKE
GAIFWMDSLAIPANAKNPEGAMKLINFLLRPDVAAQVAETIGYPTPNLAAQKLLPKEVVS
DKSLYPDAETIAKGEWQNDVGSASEIYETDFQKLKAGR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgggagctcatgccgcacatgctgccgatgcgccgaaaaccgacaataatacggtctac
ttctacaactggaccgaatatgtcccgccggggctgctggagcagttcactaaggaaacc
ggaatcaaagtcatctattcgacttatgaatccaatgaaaccatgtacgccaagctgaag
acgtaccgggaaggcgcctacgacctggtggtaccctccacctactacgtcgccaaaatg
cgtaacgaagggatgctgcaaaagatcgatcacgacaagctgagcaacttccacaacctg
gatcccaatctgctgcacaagtcgtttgacccgaagaatgactattccatcccctacatc
tggggcgcgacggcgatcggggtcaacagcgatgccatcgatccggccagcgtgaccagt
tgggccgacctgtggaagccggagtataagggcagcctgctgctgacggacgacgcgcgc
gaagtgttccaggtcgccctgcgcaagctgggttactcgggcaataccaccgatcccaag
cagatccaggcggcctatcaggcgctggtgaagctgatgcccaacgtgctggccttcaac
tccgataacccggccaacccgtttatggagggtgaagtcaatctgggcatgatctggaac
ggctccgcctatgtggcgcgccaggccggcacgccggtgcagatcgtctggccgaaagag
ggcgccattttctggatggacagcctggccattccggccaatgccaaaaatcccgaaggc
gcgatgaagctgattaacttcctgctgcgtccggacgtcgccgcgcaggtcgcggaaact
atcggctacccgaccccgaacctggcggcccaaaagctgctgccgaaagaggtggtcagc
gacaagtcgctctacccggatgcggaaaccatcgccaagggcgagtggcagaatgacgtc
ggcagcgccagcgaaatctacgaaaccgatttccagaagctgaaggccggacgctaa

DBGET integrated database retrieval system