KEGG   Edwardsiella piscicida C07-087: ETAC_08955Help
Entry
ETAC_08955        CDS       T02509                                 

Definition
(GenBank) Serine acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00270  Cysteine and methionine metabolism
etc00920  Sulfur metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ETAC_08955
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ETAC_08955
Enzymes [BR:etc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     ETAC_08955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2
Motif
Other DBs
NCBI-ProteinID: AGH73912
Position
2038735..2039307
Genome map
AA seq 190 aa AA seqDB search
MTILRYIRSDLHRYVGPERIGVRTFIVEYVKNPGFKFSVWLRLCHSRCRPLRALARLQHF
RFKRKYFLEIPYQTRIGYGLYLGHAGCIVVSPTASIGNNVNLSHFSTVGAVHTPAAVIGD
RVYVGPSACLVGAVTIGSDVKIGAGAVVTHDIPAHSVAAGVPARPIGACANNDYIQWPWP
VEAPAPTEER
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatccttcgctacatccgcagcgatctgcaccgctacgtcggcccggaacggatc
ggcgtaaggacgtttattgtcgaatacgtgaaaaaccccgggttcaagttcagcgtatgg
ctgcgcctgtgccatagccgctgccggccgctgcgggcgctggcgcggctacagcatttc
cgctttaaacgaaagtacttcctggagatcccctaccagacccggatcggctacggactt
tatctggggcacgcgggctgtatcgtggtcagccccacggcgagcatcggtaataacgtt
aacctgtcccacttctctaccgtcggcgccgtacacacgccggcggccgtcatcggcgat
cgggtctacgtcggccccagcgcctgcctcgtcggcgccgtcaccattggcagcgatgtc
aaaatcggcgccggcgccgtcgtcacccacgatattccggcgcacagcgtcgccgccggg
gttcccgcccgcccgatcggcgcctgcgcaaacaatgactatattcagtggccctggccc
gtcgaggcgcccgcgccgacggaagagcgctga

KEGG   Edwardsiella piscicida C07-087: ETAC_16605Help
Entry
ETAC_16605        CDS       T02509                                 

Gene name
cysE
Definition
(GenBank) serine acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00270  Cysteine and methionine metabolism
etc00920  Sulfur metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ETAC_16605 (cysE)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ETAC_16605 (cysE)
Enzymes [BR:etc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     ETAC_16605 (cysE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SATase_N Hexapep Hexapep_2 Bactofilin
Motif
Other DBs
NCBI-ProteinID: AGH75442
Position
complement(3740293..3741114)
Genome map
AA seq 273 aa AA seqDB search
MSTEELEIIWQNIKTEAWGLAECEPMLASFFHATLLKHENLSGALSYILANKLADPIMPA
IAIREVAEEAYRADPRMVDYAARDILAVRQRDPAVDKYSTPLLYLKGFHALQAYRIGHWL
WRQERRALAIYLQNQISVAFGVDIHPAARIGCGIMLDHATGIVIGETAVVENDVSILQSV
TLGGTGKECGDRHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLHPVPDHTTVAGVP
ARIVGRPESDKPSMDMDQRFNGNSHDFADGSGI
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacagaagaattggaaatcatctggcaaaacattaaaacagaggcttggggactg
gcggagtgcgagccgatgctggccagttttttccatgccaccttgctgaagcatgaaaac
ctgtccggcgcactgagctatattttggccaataaattggccgatccgattatgccggcc
atcgccatccgtgaagtggccgaagaggcctatcgcgccgatccccgcatggtggactat
gccgcgcgcgatatcctggcggttcgccagcgcgatccggcggtagataagtattcgacg
ccgctgctgtacctcaaagggtttcatgcgctgcaggcctatcgcatcgggcattggtta
tggcgtcaggagcggcgtgccctggcgatttatctgcagaatcagatctcggtggccttt
ggcgtcgatattcatccggcggcgcgcattggctgtgggatcatgctcgatcatgccacc
gggattgtgatcggtgaaacggcggtcgtggagaatgatgtctctatcctgcagtcggtc
acgctgggcggtaccgggaaagagtgcggcgatcgccatcctaagatccgcgaaggggtg
atgatcggcgcgggcgctaaaattctgggtaatatcgaggtagggcgcggagccaagatc
ggcgcaggctccgtggtgctgcacccggtacccgaccacacgacggtggcgggcgttccg
gcgcggattgtcggccgcccagagagcgataagccgtccatggacatggatcagcgcttt
aacggcaacagtcatgattttgcggacggcagcggtatttaa

DBGET integrated database retrieval system