KEGG   Edwardsiella piscicida C07-087: ETAC_09010Help
Entry
ETAC_09010        CDS       T02509                                 

Definition
(GenBank) Vibrioferrin decarboxylase protein PvsE
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00300  Lysine biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    ETAC_09010
Enzymes [BR:etc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     ETAC_09010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC Ala_racemase_N
Motif
Other DBs
NCBI-ProteinID: AGH73923
Position
2050335..2051507
Genome map
AA seq 390 aa AA seqDB search
MTPLVTREIQRLQQRHTPFCGYLYDLSALRERIATMKRLLPEHCELFYAAKANAEAPILH
TLAPWVDGFEAASGGELAWLAQQSLDSRLLFGGPGKLTRELEQACDLRVDALHVESLGEL
RRLAALAERRRQTLPLLLRMNIPLPGGAETPLMMGGKPTPFGLDPADLAPALRLIGDARW
LRLRGFHFHLLSHQLSVDSHLALIQHCLTQVQRWCQQFHLQIEMVNLGGGFGINYRDPAR
HFDWADFCQRLPAVRRACRADPWLLRFECGRYISAPCGYYVMEVLDIKRNLGEWFAVGHG
GTHHFRTPAAQGHDHPFQVVRRDTPPEIRDRRVTLVGQLCTPKDVLARRQPIAALATGDW
LIFPLAGAYAWNISHRHFLMHAEPHTVWLE
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccttggtaacacgtgaaatacagcggctgcagcagcgccataccccgttttgc
ggctacctttacgatctctccgccctgcgcgaacgcatcgcgacgatgaagcgccttctg
cccgagcactgtgagctgttttacgccgcgaaggccaacgccgaagcgccgatcctgcac
accctggcgccgtgggtcgatggctttgaggcggcctccggcggcgagctggcctggctg
gcgcagcagtcgctggacagccggctcctgttcggcggccccggcaagctgacccgcgag
ctggagcaggcctgcgatctgcgcgtcgacgctctgcacgtcgaaagcctgggcgagctg
cggcgcctggcggcgctggccgaacgccggcgccagacgctgcccctgctgctgcgcatg
aacattccgctgcccggcggcgcggagacgccgctgatgatgggcggcaagccgaccccc
ttcggcctggaccccgccgatctggcgccggcgctgcggctcatcggcgacgcccgctgg
ctgcggctgcgcggctttcactttcacctgctctcccaccagctcagcgtggacagccac
ctggcgctgatccagcactgcctgacccaggtccagcgctggtgccagcagtttcacctg
cagatagagatggtcaatctcggcggcggcttcggcattaactaccgcgatcccgcccgc
cacttcgactgggccgacttttgccagcggctgcccgccgttcgccgcgcctgtcgggcc
gacccctggctgctgcgctttgagtgcgggcgctacatcagcgccccctgcggctattac
gtcatggaggtgctggacatcaagcgcaatctgggcgagtggttcgccgtcggccacggc
ggcacccatcactttcgcaccccggcggcgcagggccatgaccatccgttccaggtggtg
cgccgcgacacgccgccggagatccgcgatcggcgcgtcacgctggtcggccagctgtgc
acccccaaggatgtcctggcgcgccgccagcctatcgccgcgctggcgacgggcgactgg
ctgatctttccgctggcgggggcctacgcctggaacatctctcatcgccactttctgatg
cacgccgagccgcacaccgtttggctcgagtga

KEGG   Edwardsiella piscicida C07-087: ETAC_14025Help
Entry
ETAC_14025        CDS       T02509                                 

Definition
(GenBank) diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00300  Lysine biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    ETAC_14025
Enzymes [BR:etc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     ETAC_14025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC
Motif
Other DBs
NCBI-ProteinID: AGH74926
Position
complement(3159473..3160732)
Genome map
AA seq 419 aa AA seqDB search
MPYPLNQAGYALNDSLLAALPGRFGTPLWVYDAALIERQIASLRAFDTIRFAQKACSNLH
ILRLMRQAGVKVDAVSLGEIERALVAGFRPGGDDEEIVFTADVIDEATLDRICALGITVN
AGSCDMLRQLGRRASGHPVWLRINPGFGHGHSQKTNTGGENSKHGIWHQDLAQALALIDT
YGLRLVGLHMHIGSGVDYDHLARVCDTLANQAIALGRDIQAISAGGGLSIPYRDGDAAVD
VRHYYGLWDAARRRIAAHLGHPVRLEIEPGRYLVAQAGVLLAQVRAVKSMGQRHFVLADA
GFNDLMRPAMYGSHHHISLLPQDGRDVATPCIETVVGGPLCESGDVFTQREGGKVTSCAL
PAAQVGDWLVFHDTGAYGASMSSNYNSRPLLPEVLVEGNKARLIRRRQRMDELLALEQI
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgccctatcctctgaatcaggccggttatgccctgaatgactcgctgctcgccgctctg
ccgggccgctttggtacgccgctgtgggtttatgacgcggcgctgatcgaacgccagata
gcctctctgcgcgccttcgacaccattcgcttcgcgcagaaagcctgctccaacctgcat
attctgcggctgatgcgtcaggccggagtgaaggtagacgcggtatcgctgggggagatt
gagcgggcgctggtggcgggatttcgcccgggcggcgacgatgaggagatcgtctttacc
gccgacgtgatcgatgaggcgacgctggatcggatctgtgcgctggggatcacggttaac
gcgggatcctgcgacatgctgcgccagctgggccgccgagcctctgggcacccggtctgg
ctgcgcatcaatccgggctttggccacggccacagccagaagaccaataccggcggagaa
aacagcaagcacggcatctggcatcaggatttggcgcaggcgctggccctgatcgatacc
tacggcctgcgtctggtcggcctgcatatgcacattggctccggcgtggattacgaccac
ctggcccgggtctgcgatacgctggccaaccaggcgatcgcgctggggcgtgatatccag
gcgatttccgccggcggggggctcagcataccctaccgcgacggcgacgccgcggtggac
gtcaggcactactatgggctgtgggatgcggcgcggcggcgtatcgccgcgcatctgggg
catccggtgcgtctggagatcgagccgggacgctatctggtggcgcaggccggcgtgctg
ctggcgcaggtgcgggcggtgaagtcgatgggacagcgccactttgtcctggcggacgcc
gggtttaacgatctgatgcgcccggcgatgtacggcagccatcaccatatctcgctgctg
ccgcaggatgggcgcgacgtcgcgacgccgtgcatcgaaacggtggtggggggaccgctg
tgtgagtcgggtgatgtgtttacccagcgcgaggggggcaaggtgacctcgtgcgcgctg
ccggcggcgcaggtgggagactggctggtgtttcacgataccggcgcctacggggcctcg
atgtcctccaactataacagccgtccgctgctgccggaggtgctggtggaggggaataag
gcccggctgatccgccgtcgtcagcgaatggatgagctattggcgctggagcagatataa

KEGG   Edwardsiella piscicida C07-087: ETAC_14815Help
Entry
ETAC_14815        CDS       T02509                                 

Definition
(GenBank) diaminopimelate decarboxylase
  KO
K23385  D-ornithine/D-lysine decarboxylase [EC:4.1.1.116]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    ETAC_14815
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    ETAC_14815
Enzymes [BR:etc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.116  D-ornithine/D-lysine decarboxylase
     ETAC_14815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC Ala_racemase_N
Motif
Other DBs
NCBI-ProteinID: AGH75084
Position
complement(3352916..3354313)
Genome map
AA seq 465 aa AA seqDB search
MSDNVIKNYNQLRHNVIEHDRRFSARGGKLCFEGQDVTALAKKYGTPFYVFSEAEIVRNI
REIEQAFSAHPNTKTFFASKTCSVMGVLQAIRDAGICAEANSQYEVRKCLEVGFRGDQIV
FNGVVKKPEDLEYAIANDLYLINVDSLYELDHIDAISRRLKKTANVCVRVEPNVPSATHA
ELVTAFHAKSGLDLEQAEETCRRILAMPYVHLRGLHMHVGDQVPEAEPFAKATRVLVDES
RRLEQVLGITFDLINVGGGIPVPYKYDEENGDPLKDNMYAGITAQDFADAVISEVHKWRT
DVQICIEPGRKVTGSAAVLLTEVACEKRKTNYDVDGNVECHVEWKFVDAGYSVLSDSQHF
DWFFYVYNASRITEAHDRYIKLAGPLCDGGDYFHVGVKGEEFLMPHDTAIGDVVAFLDAG
AYSIESQTVYNNRPRTAVVMIDRQGNDCLIRREDSYEDMVKYDIY
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtcagataatgttattaaaaactataaccagttgcgtcataacgtaattgaacacgac
cgtcgctttagcgcccgcggcggtaagctgtgctttgagggacaggatgtcaccgcgctg
gcgaagaagtatggcacccccttctacgtattctccgaggcggagatcgtgcgcaatatc
cgcgagatcgagcaggccttttccgcccatccgaacaccaaaaccttcttcgcctccaaa
acctgctccgtgatgggggtgctgcaggcgatccgcgacgccgggatctgcgccgaggcc
aactcgcagtatgaggtgcgcaagtgccttgaggtcggctttcgcggcgatcagatcgtg
tttaacggggtggtgaaaaagccggaggatctggagtacgccatcgccaacgatctgtac
ctgatcaacgtcgacagcctgtatgagctggaccatatcgatgcgatttcccgccgcctg
aagaagaccgccaacgtgtgcgtacgcgtcgagccgaacgtgccgtccgccacccacgcc
gagctggtcaccgcattccacgccaagtcgggcctggatctggagcaggccgaagagacc
tgccgccgtatcctggcgatgccctacgtgcatctgcgcggcctgcacatgcacgtaggc
gatcaggtgccggaggcggagccgtttgccaaagcgacccgcgtgctggtggacgaatcc
cgccgtctggagcaggtgctggggatcacgttcgatctgatcaacgtcggcggcggcatc
ccggtgccgtacaagtacgatgaagagaacggcgatccgctcaaggacaacatgtacgcc
gggatcaccgcgcaggactttgccgatgccgtcatcagcgaggtgcacaagtggcgcacc
gacgtgcagatctgtatcgagccggggcgcaaggtgaccggttcggcggcggttctgctg
acggaggtggcctgcgagaagcgtaagaccaactacgatgtggacggtaacgtggagtgc
cacgtggagtggaagtttgtcgacgccggctacagcgtcctttccgacagccagcacttt
gactggttcttctatgtctataacgcctcgcgcatcaccgaagcgcacgatcgctacatc
aagctggcgggtccgctgtgcgacggcggcgactacttccacgtcggcgtgaagggcgag
gagttcctgatgccgcacgacacggcgatcggcgacgtcgtcgcattcctggacgccggc
gcctactcgatcgaaagccagacggtctataacaaccgtccgcgcaccgcggtggtgatg
atcgatcgtcagggcaatgattgcctgatccgtcgtgaggacagctacgaagacatggtc
aagtacgacatttattaa

DBGET integrated database retrieval system