KEGG   Edwardsiella piscicida C07-087: ETAC_09105Help
Entry
ETAC_09105        CDS       T02509                                 

Definition
(GenBank) cobalt transport protein CbiN
  KO
K02009  cobalt/nickel transport protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00245  Cobalt/nickel transport system
etc_M00246  Nickel transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_09105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_09105
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Cobalt transporter [MD:M00245]
    ETAC_09105
   Nickel transporter [MD:M00246]
    ETAC_09105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiN
Motif
Other DBs
NCBI-ProteinID: AGH73942
Position
complement(2071460..2071741)
Genome map
AA seq 93 aa AA seqDB search
MKKTLILLAMVIALVILPFFIDHGGEFGGADGEAESQILAIAPHYEPWFQPLYQPASGEI
ESLLFTLQGSLGAAVIFYILGYAKGRQRRDDRT
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagacgttaatactgctggcgatggtgattgcgctggtgatcctgcctttcttt
atcgatcacgggggcgagttcggcggcgcggatggggaggccgaaagccagatcctcgcg
atcgcgccgcactatgagccctggttccagccgctgtatcaacccgccagcggcgagata
gagagcctgctgtttaccctgcagggctcccttggcgcggcggtgatcttctacattctg
ggatacgccaagggcaggcagcgccgtgatgaccggacttga

DBGET integrated database retrieval system