KEGG   Edwardsiella piscicida C07-087: ETAC_09145Help
Entry
ETAC_09145        CDS       T02509                                 

Definition
(GenBank) cobalt-precorrin-6Y C(15)-methyltransferase
  KO
K02191  cobalt-precorrin-6B (C15)-methyltransferase [EC:2.1.1.196]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00860  Porphyrin and chlorophyll metabolism
etc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ETAC_09145
Enzymes [BR:etc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.196  cobalt-precorrin-6B (C15)-methyltransferase [decarboxylating]
     ETAC_09145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS PCMT Methyltransf_31 GidB PrmA Cons_hypoth95 Methyltransf_25 Methyltransf_4 Met_10 Methyltransf_12 Methyltransf_11 Methyltransf_15 Methyltransf_18 CMAS Methyltransf_2 Methyltransf_23 DOT1 Methyltr_RsmB-F Methyltransf_3 PRMT5 RrnaAD Methyltransf_16
Motif
Other DBs
NCBI-ProteinID: AGH73950
Position
complement(2077301..2077870)
Genome map
AA seq 189 aa AA seqDB search
MNDELFLRGETVPMTKEAVRALALSKLALHRARHLIDIGAGTGSVSIEAALQFPSLRVTA
IEKNPAALRLLAENCQRFACDNVSILPGTAPMPVAARADAVFMGGSGGHLTALMDWSMAQ
LHPGGRLVMTFILMENLHSALAYLAQRGAQGVTCQQIQTASWVPLGKGHYFKPNNPVFVI
ACQKEEHHV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatgagctttttctgcgcggcgaaacggtgccgatgaccaaagaggcggtgcgc
gcgctggccctcagcaaacttgcgctgcaccgagcccgccatctgattgatatcggggcg
ggaaccggcagcgtgtcgattgaggccgcgctgcagtttccctccctgcgggtgaccgcc
atcgagaaaaaccccgcggcgctgcgcctgctggcggaaaattgccagcgctttgcctgc
gacaacgtcagcattctgcccggcaccgcgccgatgccggtggcggcgcgggccgacgcc
gtgtttatgggcggcagcggcggccacctgacggcgctgatggactggtccatggcgcag
ctgcatcccggcgggcgcctggtgatgacctttatcctgatggagaacctgcatagcgcg
ctggcctacctggcgcagcggggagcgcagggcgtgacgtgccagcagatacagacggcg
tcgtgggttccgctcggcaagggccactactttaaaccgaataatcccgtttttgttatc
gcctgtcagaaggaggagcatcatgtctga

DBGET integrated database retrieval system