KEGG   Edwardsiella piscicida C07-087: ETAC_09190Help
Entry
ETAC_09190        CDS       T02509                                 

Definition
(GenBank) Sensory histidine kinase AtoS
  KO
K07710  two-component system, NtrC family, sensor histidine kinase AtoS [EC:2.7.13.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00500  AtoS-AtoC (cPHB biosynthesis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_09190
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_09190
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_09190
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ETAC_09190
Protein kinases [BR:etc01001]
 Histidine kinases
  NtrC family
   ETAC_09190
Two-component system [BR:etc02022]
 NtrC family
  AtoS-AtoC [MD:M00500]
   ETAC_09190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c PAS HisKA PAS_4 PAS_9 PAS_8 HAMP HisKA_4TM HWE_HK HisKA_2
Motif
Other DBs
NCBI-ProteinID: AGH73959
Position
2085725..2087497
Genome map
AA seq 590 aa AA seqDB search
MAILMVIVPTLSIGYIVEIEGRSAVLAEKEKKLAAVVQLLDQALGERLDHFSALPRAERI
RALNAELSPITERITQAFPGIGAGYYSKTLDAIITYAPFALYQSNVGVTIAADHPGREVM
RSDTPIVFSGHQVRGDILNSMRPIRRDGEVTGYIWANELTQDIHRQARQMDLRIMAALAA
GLLCSLLLIVLFSRRFSANIDIITEGISTLAHKTPAPLPELPGELGQISRSINALAQTLR
ETKTLNDLIIENAADGVIAIDRLGAVTTINPAAEAITGYTRDELVGQPYAALFSDSHFAS
PVLDTLAHGTAHLAQEVSFPARHRTIEISVTTSRIHNPHGELMGALVIFSDLTARKETQR
RLAQTERLATLGELMAGVAHEVRNPLTAIRGYVQIIRQQTTQPAHQEYLSVVLKEIDSIN
KVIQQLLDFSRPRQSQWQQVSLNALIEEALILVQTSGVQARIAFHCALDRRLPAIVADRE
LLKQVLLNILINAVQAISARGEIRIRTWQPAPAQQAVAIEDSGCGIDIALQQKIFDPFFT
TKASGTGLGLALSQRIINAHRGDIDVVSTPGGGSTFTLTLPRNPPESPAE
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcctgatggtcatcgtaccgacgctgtcgattggctatatcgtcgagatcgag
gggcgctccgcggtgctggccgaaaaagagaaaaagctggccgccgtcgtgcagctgctc
gaccaggcgctgggcgaacgcctggaccacttctcggcgctgccgcgcgctgagcgtatc
cgggcgctgaatgccgagctcagccccatcaccgagcgcatcacccaggcgtttcccggc
atcggcgcgggctactacagcaaaacgctggatgcgattattacctatgccccgttcgcg
ctgtatcaaagcaacgtcggcgtgaccattgccgccgaccaccccggacgcgaagtgatg
cgcagcgatacgccgatcgtcttttccggccaccaggtgcgcggcgatattctcaactcg
atgcgccccattcggcgagacggcgaggtgacgggctacatctgggccaatgagctgacg
caggatattcaccgtcaggctcgccagatggatctgcgcattatggcggcgctggcggcg
ggtctgctgtgcagcctgctgctgatcgtcctcttttcacggcgcttcagcgccaatatc
gacatcatcaccgaggggatctcgacgctggcgcataaaacgccggcgccgctccccgag
ctacccggcgagctggggcaaatcagccgcagcatcaacgcgctggcgcaaacgctgcgc
gagaccaaaacccttaacgatctgatcattgaaaacgccgccgacggggtgatcgccatc
gacaggctgggtgcggtcaccaccatcaaccccgcggcagaggccatcaccggctatacg
cgggatgagctggtgggacagccctacgccgccctgttctccgactcccatttcgccagt
ccggtgctggataccctagcgcacggcaccgcccacctggcgcaagaggtcagcttcccg
gcgcgtcatcgcaccattgagatcagcgtcaccaccagccgcatccacaatccccatggc
gaactgatgggggcgctggtgattttttccgatctgaccgcccgcaaagagacccagcgc
cgcctggcgcaaaccgaaaggcttgccacgctgggcgagctgatggccggcgtcgcccat
gaggtgcgcaatccgctgaccgccatccgcggctacgtgcagatcatccgccaacagacc
acccagccagcgcatcaggagtacctgtccgtggtactcaaagagattgattctattaat
aaagttattcagcagctgctcgacttctcccggccgcggcaaagccagtggcagcaggtg
tcgctcaacgcgctgatcgaagaggcgctgatcctggtgcaaacctccggggttcaggcg
cggatcgccttccactgcgcgctggacaggaggctgccggcgatcgtggccgatcgcgag
ctgctcaagcaggtgctgctgaacatcttaatcaatgcggtgcaggccatcagcgcgcgc
ggcgagattcgcatacgcacctggcaacccgccccggcgcagcaggcggtggcgatagag
gacagcggctgcggcatcgatatcgcgctacagcaaaaaatcttcgatcccttcttcacc
accaaggcctcggggaccggcctggggctggcgctgagccagcgcatcatcaacgcccac
cggggggatattgacgtggtcagcacgccgggaggcggttcgacctttaccctcacgtta
ccgcgcaatccgccggagagcccagcagaatga

DBGET integrated database retrieval system