KEGG   Edwardsiella piscicida C07-087: ETAC_09195Help
Entry
ETAC_09195        CDS       T02509                                 

Definition
(GenBank) acetoacetate metabolism regulatory protein AtoC
  KO
K07714  two-component system, NtrC family, response regulator AtoC
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00500  AtoS-AtoC (cPHB biosynthesis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_09195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_09195
Two-component system [BR:etc02022]
 NtrC family
  AtoS-AtoC [MD:M00500]
   ETAC_09195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat Response_reg Sigma54_activ_2 HTH_8 AAA_5 AAA Mg_chelatase HTH_50 FleQ AAA_3 AAA_16
Motif
Other DBs
NCBI-ProteinID: AGH73960
Position
2087494..2088879
Genome map
AA seq 461 aa AA seqDB search
MKTRNRILIVDDEDNVRRMLTTALTLQGHETHTASHGAEALQRFADAPPDVVLMDIRMPT
MNGIDALKVMRARQPRTPVILMTAYAEVETAVEALRSGAFDYVIKPFDLDELNLLIQRAL
QLQAMKQEIRSLHQALSTRWQWGHILTNSPRMMDICKDTAKIALSQANVLISGESGTGKE
LIARAIHYGSRRASGPFIKVNCAALPESLLESELFGHEKGAFTGAQTQRQGLFERAHRGT
LLLDEIGEMPPPLQAKLLRILQEREFERVGGHQTIRVDIRIVAATNRDLQAMVREGGFRN
DLFYRLNVIHLPLPPLRERRQDIALLANHFLQKFSSENQRDMIEIDPAAMSLLSAWPWPG
NIRELSNVIERAVVMSTGAVIFADDLPAPLHQPIGGGAGAKSAPPGERNLKEEIKREERR
IISEVLEQQAGNRTRTALMLGISRRALMYKLQEYGIDPAGC
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgcaaccgtattctcatcgtggatgacgaagataacgtacgccgcatgctc
accaccgcgttgacgctccaggggcatgaaacacacaccgccagccacggggccgaggcg
ctgcagcgctttgccgacgcgccgccggacgtggtgctgatggatatccgtatgccgacc
atgaacgggatcgacgccctgaaagtcatgcgcgcccggcagccgcgcacccccgtcatt
ctgatgaccgcctacgccgaggtggagaccgccgtcgaggcgctgcgcagcggcgcattc
gattatgtgatcaagcccttcgatctggatgagctgaacttactgatccagcgcgcgctg
cagctgcaggcgatgaagcaggagatccgcagcctgcatcaggccctgagcacccgctgg
cagtggggacatatcctgaccaacagcccgcgcatgatggatatctgcaaagacaccgcg
aaaatcgccctttcgcaggccaacgtgctgatcagcggggagagcggaaccggcaaggag
ctgattgcccgcgccattcactacggctcgcggcgcgcaagcggcccctttatcaaggtc
aactgcgccgccctgccggagtcgctgctggagagcgagctgttcggccatgagaagggc
gcattcaccggcgcgcagacccagcgccaggggctgtttgagcgcgcccatcggggcacc
ctgctgctggatgaaatcggcgaaatgccgccgccgctgcaggccaagctgctgcggatc
ctgcaggaaagggagttcgagcgcgtggggggacaccaaaccattcgggtggatatccgc
atcgtggccgccaccaaccgggatttacaggcgatggtgcgcgagggcggcttccgtaac
gatctcttctatcgcctgaacgtcattcatctgccgctgccgccgctgcgcgagcggcgg
caggacatcgccctgctcgccaaccatttcttacaaaagttcagctcggagaaccagcgc
gacatgattgagatcgatccggcggcgatgtcgctgctcagcgcctggccctggccgggc
aacatccgcgagctctccaacgtcatcgagcgcgcggtggtgatgagcaccggcgcggtc
atttttgccgacgatctgccggctccgctgcaccagcccatcggcggcggcgctggcgcc
aaaagcgccccgcccggcgagcgcaatctgaaagaggagatcaagcgcgaggagcggcgc
atcatcagcgaggtgctcgaacagcaggcgggaaaccgcacccgcaccgccctgatgctg
ggtatcagccgccgcgccctgatgtacaagctgcaggagtacggcatcgatccggccggg
tgctag

DBGET integrated database retrieval system